Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.1e-09
medulloblastoma 720 7.6e-05
tuberculosis 2010 1.0e-03
lung cancer 4740 2.5e-03
pancreatic cancer 2398 6.0e-03
pancreatic carcinoma 562 6.0e-03
adrenocortical carcinoma 1428 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma 1.017 1.5e-02
lung cancer 2.300 2.5e-03
medulloblastoma 1.200 7.6e-05
ovarian cancer -1.100 4.1e-09
pancreatic cancer 1.100 6.0e-03
pancreatic carcinoma 1.100 6.0e-03
tuberculosis -1.300 1.0e-03

AA Sequence

MPSQNYDLPQKKQEKMTKFQEAVTFKDVAVVFSREELRLLDLTQRKLYRDVMVENFKNLVAVGHLPFQPD      1 - 70
MVSQLEAEEKLWMMETETQRSSKHQNKMETLQKFALKYLSNQELSCWQIWKQVASELTRCLQGKSSQLLQ     71 - 140
GDSIQVSENENNIMNPKGDSSIYIENQEFPFWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKK    141 - 210
SPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPLGEKPHPCGECGRGFSYSPRLPLHPNVHTGEKCFSQ    211 - 280
SSHLRTHQRIHPGEKLNRCHESGDCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEK    281 - 350
PYKCEECGKCFSQSSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQA    351 - 420
AHFHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFTRNTDLHIHFRVHTGEK    421 - 490
PYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFSYS    491 - 560
SNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEQCDKSFSQAIDFRVHQRVHTGEK    561 - 630
PYKCGVCGKGFSQSSGLQSHQRVHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRS    631 - 700
LNLRHHQRVHTGEKPHICEECGKAFSLPSNLRVHLGVHTREKLFKCEECGKGFSQSARLEAHQRVHTGEK    701 - 770
PYKCDICDKDFRHRSRLTYHQKVHTGKKL                                             771 - 799
//

Text Mined References (8)

PMID Year Title