Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.10
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.27663846906279E-27

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession Q86WZ0 B7Z7V9 E9KL41
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MTRTQKGKTFLPHCFYQSLPPRLGWGMILNYSKLKGKEECASVSSVPMVFFSSQYRLHRKSQYLKMAAAN      1 - 70
LTFSQEVVWQRGLPSIPYSQYSFDHLYNTNDIIHTPQIRKARPQKPVSFKFLGSSSPLTGDTSLAVKTES     71 - 140
SANPEKKLKKSKPASTVREAPRPLIHHPCMHPDMLGRPPSLDVNLEEREAWLLPPEKEARAWEATVLEKL    141 - 210
NERTARWIQSKRPRRPGASPNKWQSFLRQQYDWSHIRDELTSASDLELLKQLEAEETAEFEDQSVILPPQ    211 - 280
EKKKPELLLPVYYRLPSYFQQAETVEIMPGNKSTEDIHEKTSLSQPQTQSYFRQVTPRAGKFAYSTDNTF    281 - 350
EQEIYFDEVQIIHQIGAKRDQIVLENLNRYNKQLSKVFPETPEKWSAQAIPEASYRPVQGALRWTALPTP    351 - 420
AKDMLLQVGEKDVPIKTRRLKKQAKSLQEDVTWELVVLRRMLKEWKTAWALIIEWHHETVENLLQSLGDL    421 - 490
HDDVRIKAITTCATAALERPRIATSQRDSDKTIQDLPEVLLPALEAALCDKNAHVRMAAAICQYAIQSHN    491 - 560
PLARNIMQTALLKGNSVDSWAAAQCLALEGTATYPVIKRILHQLFTKKNEDTEEQSYILLSYLSEKTTLI    561 - 630
HTMLAVELNSCQWKNRIVACQAFSRISGNVCLDMKHKLIQLMWNDWNKEVRRAAAQALGQMSLGKEVHDI    631 - 700
IRVKLGQGNSQERVEALYLIGELKLMTAKLLPSFLHCFSDDFTAVRRAACLAAGALQIRDKMVLECLLNL    701 - 770
MQRDPYWKIKAFAIRALGQIGQVSPELTDLLLWAIHYEESPGVRLEACRSILALKLQGDRVRDTFLDVLL    771 - 840
LENHDAVLKEMYQTMKILNLGNEGNQEMLQEIKNRIKTLSQKDLLTHKILKLEMVMGKVREEAKRVYLKP    841 - 910
KGEQGPLTLQTLLQETFQDEMVLPRRPSEVCDTEAVIKPVKPRAPNPWLQSSVPGLTTRSKVRSSLVKDL    911 - 980
RTSPEKRIAVGPFRSDYPALYLGKFSERTFFSPIMSSPSGKKGAHL                            981 - 1026
//

Text Mined References (7)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.