Property Summary

NCBI Gene PubMed Count 17
Grant Count 4
R01 Count 3
Funding $650,256
PubMed Score 46.17
PubTator Score 9.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
glioblastoma -1.100 0.001

Synonym

Accession Q86WX3 B0QY96 Q5JZA1
Symbols AROS
S19BP

Gene

Gene RIF (6)

PMID Text
26339164 AROS is a significant biomarker for tumor aggressiveness in non-cirrhotic hepatocellular carcinoma.
24681097 In vitro SIRT1 activity assays disclose AROS as an inhibitor of SIRT1.
24258275 study demonstrated a cancer-specific role for AROS in the regulation of survival in a panel of human cell lines; data suggest that AROS, as well as SIRT1, promotes survival in cancer cells while being redundant for viability in non-cancer cells
23548308 This study analyses Sirt1 modulation by several putative Sirt1 regulators, showing that the regulator protein AROS has an unusual conformation and that the Sirt1 catalytic domain is sufficient for modulation by resveratrol.
23349863 we found that the SIRT1 modulators AROS and DBC1 have an impact on hsp70 transcription, HSF1 acetylation status, and HSF1 recruitment to the hsp70 promoter.
17964266 Active regulator of SIRT1 (AROS) is the first direct SIRT1 regulator to be identified that modulates p53-mediated growth regulation.

AA Sequence

MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRD      1 - 70
HLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS         71 - 136
//

Publication (20)

PMID Year Title
26339164 2015 AROS Is a Significant Biomarker for Tumor Aggressiveness in Non-cirrhotic Hepatocellular Carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24681097 2014 AROS has a context-dependent effect on SIRT1.
24258275 2013 Active regulator of SIRT1 is required for cancer cell survival but not for SIRT1 activity.
23548308 2013 Molecular architecture of the human protein deacetylase Sirt1 and its regulation by AROS and resveratrol.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23349863 2013 The SIRT1 modulators AROS and DBC1 regulate HSF1 activity and the heat shock response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...