Property Summary

NCBI Gene PubMed Count 10
Grant Count 25
R01 Count 16
Funding $2,051,638.5
PubMed Score 132.57
PubTator Score 74.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Acute stress disorder 6 3.31 1.7
Thymoma 16 3.137 1.6

Expression

Gene RIF (6)

PMID Text
25684230 reveal a critical role for human Stn1 in telomere length maintenance and function, supporting the model that efficient replication of telomeric repeats is critical for long-term viability of normal somatic mammalian cells
24025336 TEN1 likely functions in conjunction with CTC1 and STN1 at the telomere and elsewhere in the genome.
23851344 The mammalian CST (CTC1-STN1-TEN1) complex is directly involved at several stages of telomere end formation and CST seems to play critical roles in coordinating telomerase elongation and fill-in synthesis to complete telomere replication.
23826127 data indicate that hTen1 is critical for the telomeric function of hCST, both in telomere protection and downregulation of telomerase function
22763445 the human CST (CTC1, STN1 and TEN1) complex, previously implicated in telomere protection and DNA metabolism, inhibits telomerase activity through primer sequestration and physical interaction with the protection of telomeres 1 (POT1)-TPP1 telomerase processivity factor
19854130 Ctc1-Stn1-Ten1 is a replication protein A (RPA)-like complex that is not directly involved in conventional DNA replication at forks but plays a role in DNA metabolism frequently required by telomeres.

AA Sequence

MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVG      1 - 70
SLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGGSQ                      71 - 123
//

Publication (15)

PMID Year Title
25684230 2015 Stn1 is critical for telomere maintenance and long-term viability of somatic human cells.
25483097 2014 Human CST abundance determines recovery from diverse forms of DNA damage and replication stress.
24025336 2013 Human TEN1 maintains telomere integrity and functions in genome-wide replication restart.
23851344 CST for the grand finale of telomere replication.
23826127 2013 Structure of the human telomeric Stn1-Ten1 capping complex.
22863775 2012 Human CST promotes telomere duplex replication and general replication restart after fork stalling.
22763445 2012 The human CST complex is a terminator of telomerase activity.
19854130 2009 RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...