Property Summary

NCBI Gene PubMed Count 13
PubMed Score 142.01
PubTator Score 74.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acute stress disorder 6 3.269 1.6
Thymoma 16 3.127 1.6

Expression

Gene RIF (9)

AA Sequence

MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVG      1 - 70
SLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGGSQ                      71 - 123
//

Text Mined References (18)

PMID Year Title