Property Summary

NCBI Gene PubMed Count 29
Grant Count 24
R01 Count 12
Funding $1,145,549.41
PubMed Score 23.55
PubTator Score 22.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.180 0.000
tuberculosis 1.400 0.000
lung cancer -1.800 0.000
lung carcinoma 1.200 0.000
acute myeloid leukemia -1.100 0.030
ovarian cancer 1.200 0.000
Breast cancer -1.200 0.005

Gene RIF (15)

PMID Text
24368808 SKAP55 dimers stabilize SLP-76 microclusters, couple SLP-76 to the force-generating systems responsible for microcluster movement, and enable adhesion via the TCR by mechanisms independent of RIAM, talin, and beta1 integrins.
24162774 HIV-1 gp120 downregulates the expression of src kinase associated phosphoprotein 1 (SKAP1) in human B cells
21669874 N-terminal myr-tagged SKAP1 for membrane binding facilitated constitutive RapL membrane and Rap1 binding and effectively substituted for PI3K and TCR ligation in the activation of LFA-1 in T cells.
21652578 single-nucleotide polymorphisms in ARRDC3, FLT1, and SKAP1 were significant predictors for survival androgen-deprivation therapy in prostate cancer patients.
20852632 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852632 Single nucleotide polymorphism in SKAP1 is associated with ovarian cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346707 findings define a T cell receptor "inside-out" pathway via N-SKAP1-C-RapL that regulates T cell adhesion, motility, and arrest times with dendritic cells in lymph nodes.
19667759 SKAP1 protein as a novel regulator of the metaphase-to-anaphase transition and demonstrates that misregulation of the separase activation results in a reduced fidelity of chromosome segregation and a reduced genomic stability independent of the SAC.
17658605 These results suggest that SKAP55 modulates signal transduction from the T cell antigen receptor to Ras by binding to RasGRP1.
More...

AA Sequence

MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDD      1 - 70
NHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLF     71 - 140
YYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLK    141 - 210
DLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHD    211 - 280
LEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYL    281 - 350
TTAFEVEER                                                                 351 - 359
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24368808 2013 The N terminus of SKAP55 enables T cell adhesion to TCR and integrin ligands via distinct mechanisms.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
21669874 2011 SKAP1 protein PH domain determines RapL membrane localization and Rap1 protein complex formation for T cell receptor (TCR) activation of LFA-1.
21652578 2012 Genetic polymorphisms in androgen receptor-binding sites predict survival in prostate cancer patients receiving androgen-deprivation therapy.
20852632 2010 A genome-wide association study identifies susceptibility loci for ovarian cancer at 2q31 and 8q24.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346707 2010 T cell receptor "inside-out" pathway via signaling module SKAP1-RapL regulates T cell motility and interactions in lymph nodes.
19798671 2009 A novel S3S-TAP-tag for the isolation of T-cell interaction partners of adhesion and degranulation promoting adaptor protein.
More...