Property Summary

NCBI Gene PubMed Count 31
PubMed Score 25.18
PubTator Score 22.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
lung carcinoma 2843 4.0e-11
tuberculosis 2010 1.6e-07
lung cancer 4740 1.3e-05
osteosarcoma 7950 5.7e-05
Breast cancer 3578 5.1e-03
acute myeloid leukemia 783 3.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.6
ovarian cancer 8520 0.0 2.79976429831554E-4
Disease Target Count Z-score Confidence
Peanut allergy 11 3.17 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
ovarian cancer 1.200 2.8e-04
acute myeloid leukemia -1.100 3.0e-02
Breast cancer -1.200 5.1e-03
lung cancer -1.800 1.3e-05
lung carcinoma 1.200 4.0e-11
osteosarcoma -2.180 5.7e-05
tuberculosis 1.400 1.6e-07

Gene RIF (16)

AA Sequence

MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDD      1 - 70
NHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLF     71 - 140
YYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLK    141 - 210
DLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHD    211 - 280
LEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYL    281 - 350
TTAFEVEER                                                                 351 - 359
//

Text Mined References (33)

PMID Year Title