Property Summary

NCBI Gene PubMed Count 9
PubMed Score 25.15
PubTator Score 51.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 6.6e-05
atypical teratoid / rhabdoid tumor -1.100 4.7e-06
breast carcinoma -1.100 6.2e-03
ductal carcinoma in situ -1.100 8.8e-03
gastric carcinoma -1.100 4.5e-02
glioblastoma -1.100 1.4e-06
group 3 medulloblastoma -1.300 3.6e-03
inflammatory breast cancer -1.500 1.3e-02
invasive ductal carcinoma -1.200 3.9e-02
medulloblastoma, large-cell -1.800 1.0e-06
pancreatic ductal adenocarcinoma liver m... -1.865 1.1e-03
primitive neuroectodermal tumor -1.200 1.6e-03
psoriasis -1.500 1.0e-23
ulcerative colitis -1.600 2.4e-06

Protein-protein Interaction (6)

Gene RIF (7)

AA Sequence

MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVV      1 - 70
WPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMDRILELNQEDFSVVVEPGVTR     71 - 140
KALNAHLRDSGLWFPVDPGADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFR    141 - 210
FGFWPEIPHHTAWYSPCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQ    211 - 280
AAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNG    281 - 350
ASDFSWAKEAEERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVG    351 - 420
HVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQ    421 - 490
LKAVLDPQGLMNPGKVL                                                         491 - 507
//

Text Mined References (10)

PMID Year Title