Property Summary

NCBI Gene PubMed Count 9
PubMed Score 21.93
PubTator Score 51.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.01438778195591E-23
medulloblastoma, large-cell 6234 1.03825337237915E-6
glioblastoma 5572 1.59463186861093E-6
ulcerative colitis 2087 2.36766368307717E-6
atypical teratoid / rhabdoid tumor 4369 4.6542832960858E-6
group 4 medulloblastoma 1875 1.05417425134175E-5
adult high grade glioma 2148 6.62637186326459E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00107720975345728
primitive neuroectodermal tumor 3031 0.00155662237749672
breast carcinoma 1614 0.00618294401079416
ductal carcinoma in situ 1745 0.00876575907352424
inflammatory breast cancer 404 0.0129524215732166
invasive ductal carcinoma 2950 0.0394919721683791
gastric carcinoma 832 0.0452592283173703

Expression

  Differential Expression (14)

Synonym

Accession Q86WU2 Q8IZK5 DLD
Symbols DLD

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
23333299 The activity and expression of the mitochondrial D-lactate dehydrogenase, is higher in prostate cancer versus normal prostate cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20499337 Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency.
19844255 Observational study of gene-disease association. (HuGE Navigator)
12127981 identification and characterization of human and mouse D-lactate dehydrogenase (NAD) [D-LDH]
11582518 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines
11125887 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines

AA Sequence

MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVV      1 - 70
WPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMDRILELNQEDFSVVVEPGVTR     71 - 140
KALNAHLRDSGLWFPVDPGADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFR    141 - 210
FGFWPEIPHHTAWYSPCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQ    211 - 280
AAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNG    281 - 350
ASDFSWAKEAEERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVG    351 - 420
HVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQ    421 - 490
LKAVLDPQGLMNPGKVL                                                         491 - 507
//

Text Mined References (10)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23665963 2013 Multidimensional prognostic risk assessment identifies association between IL12B variation and surgery in Crohn's disease.
23333299 2013 Prostate cancer cells metabolize d-lactate inside mitochondria via a D-lactate dehydrogenase which is more active and highly expressed than in normal cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20499337 2010 Elevated serum lactate dehydrogenase isoenzymes and aspartate transaminase distinguish Albers-Schönberg disease (Chloride Channel 7 Deficiency Osteopetrosis) among the sclerosing bone disorders.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127981 2002 Identification of putative mammalian D-lactate dehydrogenase enzymes.