Property Summary

NCBI Gene PubMed Count 13
Grant Count 259
R01 Count 162
Funding $23,273,392.27
PubMed Score 4.19
PubTator Score 4.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86WT6 A8MX03 Q309B0 Q4G1A5 Q6W897 Q8IYY3 Q8WY16 Q8WY17
Symbols Trif
HSD34
RNF36
HSD-34

Gene

PDB

4NQJ  

Gene RIF (4)

PMID Text
23131556 hTRIM69 is a novel E3 ubiquitin ligase identified from human testis and may function to ubiquitinate its particular substrates during spermatogenesis.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11578878 Gene and protein analysis of the mouse counterpart.

AA Sequence

MEVSTNPSSNIDPGDYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNFCEACIQDFWR      1 - 70
LQAKETFCPECKMLCQYNNCTFNPVLDKLVEKIKKLPLLKGHPQCPEHGENLKLFSKPDGKLICFQCKDA     71 - 140
RLSVGQSKEFLQISDAVHFFTEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKL    141 - 210
HQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSL    211 - 280
EQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDI    281 - 350
KKIMPDDPERFDSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRN    351 - 420
QTDLKALDLPSFSLTLTNNLDKVGIYLDYEGGQLSFYNAKTMTHIYTFSNTFMEKLYPYFCPCLNDGGEN    421 - 490
KEPLHILHPQ                                                                491 - 500
//

Publication (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23131556 2012 Characterisation of human RING finger protein TRIM69, a novel testis E3 ubiquitin ligase and its subcellular localisation.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
12837286 2003 Forced expression of RNF36 induces cell apoptosis.
More...