Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.44
PubTator Score 4.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.734 9.5e-04
active ulcerative colitis 1.156 2.5e-02
group 3 medulloblastoma -1.400 4.2e-04
interstitial cystitis 1.100 9.5e-03
intraductal papillary-mucinous neoplasm ... 1.500 6.0e-03
medulloblastoma, large-cell -1.400 3.2e-04
osteosarcoma -1.807 7.9e-06
ovarian cancer -1.300 2.8e-05
primary Sjogren syndrome 1.200 4.5e-03
psoriasis 1.100 7.8e-31
subependymal giant cell astrocytoma 1.510 4.8e-02
tuberculosis and treatment for 6 months -1.200 2.2e-02

Gene RIF (4)

AA Sequence

MEVSTNPSSNIDPGDYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNFCEACIQDFWR      1 - 70
LQAKETFCPECKMLCQYNNCTFNPVLDKLVEKIKKLPLLKGHPQCPEHGENLKLFSKPDGKLICFQCKDA     71 - 140
RLSVGQSKEFLQISDAVHFFTEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKL    141 - 210
HQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSL    211 - 280
EQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDI    281 - 350
KKIMPDDPERFDSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRN    351 - 420
QTDLKALDLPSFSLTLTNNLDKVGIYLDYEGGQLSFYNAKTMTHIYTFSNTFMEKLYPYFCPCLNDGGEN    421 - 490
KEPLHILHPQ                                                                491 - 500
//

Text Mined References (14)

PMID Year Title