Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
active ulcerative colitis -1.146 1.4e-02
interstitial cystitis -1.400 1.6e-03
intraductal papillary-mucinous carcinoma... -1.800 2.8e-02
osteosarcoma -1.444 1.5e-02
spina bifida -1.858 4.1e-02

 Compartment GO Term (1)

AA Sequence

MPVTHRKSDASDMNSDTSPSCRLRAFSRGGSLESRSSSSRSRSFTLDDESLKYLTHEEKDVLLFFEETID      1 - 70
SLDEDFEEPVLCDGGVCCLCSPSLEESTSSPSEPEDVIDLVQPAPGAGEAEGLPEGTQAAGPAPAGKEHR     71 - 140
KQDAETPPPPDPPAPETLLAPPPLPSTPDPPRRELRAPSPPVEHPRLLRSVPTPLVMAQKISERMAGNEA    141 - 210
LSPTSPFREGRPGEWRTPAARGPRSGDPGPGPSHPAQPKAPRFPSNIIVTNGAAREPRRTLSRAAVSVQE    211 - 280
RRAQVLATIHGHAGAFPAAGDAGEGAPGGGSSPERVARGRGLPGPAESLRAGGQAPRGPALANGFPSAHE    281 - 350
ALKSAPSSFAPAGKSLCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRGSSEEA    351 - 420
RREALRKLGLLRESS                                                           421 - 435
//

Text Mined References (13)

PMID Year Title