Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86WR6 Q8IY87
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEASDGQGGEGDKPLEQVTNVSCLETSSSASPARDSLMRHAKGLDQDTFKTCKEYLRPLKKFLRKLHLPR      1 - 70
DLPQKKKLKYMKQSLVVLGDHINTFLQHYCQAWEIKHWRKMLWRFISLFSELEAKQLRRLYKYTKSSQPA     71 - 140
KFLVTFCASDAPERSLLADREDSLPKLCHAWGLHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDS    141 - 210
LRELSQKPKLKRKRIKEAPETPETEP                                                211 - 236
//

Text Mined References (4)

PMID Year Title
27591891 2016 The Chromatin Remodelling Protein CHD1 Contains a Previously Unrecognised C-Terminal Helical Domain.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.