Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.44
PubTator Score 0.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.600 2.5e-08
osteosarcoma -1.067 4.9e-05
ovarian cancer -1.100 4.4e-04
pancreatic ductal adenocarcinoma liver m... -1.166 2.0e-02
psoriasis -2.000 5.2e-05

Gene RIF (1)

AA Sequence

MVFYFTSSSVNSSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMD      1 - 70
CAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVER     71 - 140
FPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM      141 - 208
//

Text Mined References (18)

PMID Year Title