Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.25
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.052 0.000

Synonym

Accession Q86WQ0 A6NGP7 B4DW92
Symbols TRA16

Gene

Gene RIF (5)

PMID Text
23129017 High TRA16 expression promotes small cell lung carcinoma by activating estrogen receptor beta and blocking testicular orphan nuclear receptor 2
22082156 Knockdown of nuclear receptor 2C2-associated protein (NR2C2AP) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
17054912 Taken together, these results suggested that TR4 should be one of important regulators of OXT gene expression.
15381082 Together, these findings provide the first in vivo evidence that an orphan nuclear receptor, such as TR4, may play major roles in the RA-mediated apoptosis or differentiation in P19 cells.
12486131 TRA16 may function as a novel repressor to selectively suppress the TR4-mediated transactivation

AA Sequence

MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGF      1 - 70
SSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV      71 - 139
//

Publication (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23129017 2013 Testicular orphan nuclear receptor 4-associated protein 16 promotes non-small cell lung carcinoma by activating estrogen receptor ? and blocking testicular orphan nuclear receptor 2.
22486638 2012 Evaluating the Cornell Scale for Depression in Dementia as a proxy measure in nursing home residents with and without dementia.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17054912 2006 Transactivation of the proximal promoter of human oxytocin gene by TR4 orphan receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381082 2004 Modulation of the retinoic acid-induced cell apoptosis and differentiation by the human TR4 orphan nuclear receptor.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...