Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.70
PubTator Score 4.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 7.36734861365126E-10
osteosarcoma 7933 2.75100237021236E-7
ovarian cancer 8492 9.14273106876239E-5
medulloblastoma, large-cell 6234 4.82201756578395E-4
tuberculosis and treatment for 3 months 327 6.92352585550922E-4
glioblastoma 5572 7.46605426003381E-4
atypical teratoid / rhabdoid tumor 4369 0.00157384687041552
chronic rhinosinusitis 512 0.00253993869796257

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.843 0.000
atypical teratoid / rhabdoid tumor -1.100 0.002
glioblastoma -1.300 0.001
medulloblastoma, large-cell -1.200 0.000
juvenile dermatomyositis 1.019 0.000
tuberculosis and treatment for 3 months -1.300 0.001
ovarian cancer 2.100 0.000
chronic rhinosinusitis -1.004 0.003

Synonym

Accession Q86WP2 A6NKW3 Q6NSH6 Q9H0D4 Q9H785 Q9NSN4
Symbols GPBP
SSH6
VASCULIN

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
17672918 occurrence of an unusual TG 3' splice site in intron 9
12842993 Vasculin is a novel vascular protein differentially expressed in human atherogenesis
11256614 This publication discusses both human and mouse GC-rich promoter binding protein.

AA Sequence

MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFAWTENRYDVNRRRHNSSDGFDSAIGRPNGGNFGRKEK      1 - 70
NGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIPDNETGRKEDKRERKQFEAEDFPSL     71 - 140
NPEYEREPNHNKSLAAGVWEYPPNPKSRAPRMLVIKKGNTKDLQLSGFPVVGNLPSQPVKNGTGPSVYKG    141 - 210
LVPKPAAPPTKPTQWKSQTKENKVGTSFPHESTFGVGNFNAFKSTAKNFSPSTNSVKECNRSNSSSPVDK    211 - 280
LNQQPRLTKLTRMRTDKKSEFLKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDEN    281 - 350
EIPQENGNASVISQQIIRSSTFPQTDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISE    351 - 420
QLQKNGLRKNGILKNGLICDFKFGPWKNSTFKPTTENDDTETSSSDTSDDDDV                     421 - 473
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19060904 2009 An empirical framework for binary interactome mapping.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...