Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $581,740.67
PubMed Score 44.26
PubTator Score 9.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hepatitis D 10 3.027 1.5
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.600 0.000

Synonym

Accession Q86WN2 IFN-epsilon
Symbols IFN-E
IFNE1
IFNT1
INFE1
PRO655

Gene

Gene RIF (10)

PMID Text
24055696 T Allele of nonsense polymorphism (rs2039381, Gln71Stop) of interferon-epsilon is a risk factor for the development of intracerebral hemorrhage.
23851686 Full-length IFN-epsilon 5'UTR markedly suppressed mRNA expression under basal conditions. It contains 2 stable stem-loop structures which associate with importin 9. Loop 1 is essential for regulation of mRNA expression.
23802172 genetic polymorphism is related to onset time of vitiligo in Korean patients
20601674 Observational study of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20574843 Observational study of gene-disease association. (HuGE Navigator)
18842358 In macrophages IFN-tau increased the synthesis of 2',5'-oligoadenylate synthetase/RNase L, MxA protein, IL-10 & IL-6, but not of IL-1ss or TNF-alpha.
18362232 A meta-analysis and a single-nucleotide polymorphism (SNP) rs1333049 representing the 9p21.3 locus provide unprecedented evidence for association between genetic variants at chromosome 9p21.3 and risk of coronary artery disease.
17878351 TNF-alpha leads to stabilization of IFN-epsilon mRNA, increased IFN-epsilon synthesis, engagement of type I IFNRs, increased STAT1 expression and phosphorylation, and up-regulation of retinoic acid-inducible gene-I expression
15233997 The structue and mRNA expression pattern of IFN-epsilon1 suggest that it may have a function distinct from those other members of type I INF.

AA Sequence

MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQ      1 - 70
QYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNL     71 - 140
RLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR      141 - 208
//

Text Mined References (17)

PMID Year Title
24055696 2014 T Allele of nonsense polymorphism (rs2039381, Gln71Stop) of interferon-? is a risk factor for the development of intracerebral hemorrhage.
24023261 2013 THOC5: a novel gene involved in HDL-cholesterol metabolism.
23851686 2013 Novel role for molecular transporter importin 9 in posttranscriptional regulation of IFN-? expression.
23802172 2013 Association study between nonsense polymorphism (rs2039381, Gln71Stop) of interferon-? and susceptibility to vitiligo in Korean population.
23449591 2013 Interferon-? protects the female reproductive tract from viral and bacterial infection.
20601674 2010 Bivariate genetic association of KIAA1797 with heart rate in American Indians: the Strong Heart Family Study.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
18842358 [Anti-HIV effects of IFN-tau in human macrophages: role of cellular antiviral factors and interleukin-6].
18362232 2008 Repeated replication and a prospective meta-analysis of the association between chromosome 9p21.3 and coronary artery disease.
More...