Property Summary

NCBI Gene PubMed Count 16
PubMed Score 47.15
PubTator Score 9.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.0e-25
Disease Target Count Z-score Confidence
Hepatitis D 10 3.01 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.600 3.0e-25

Synonym

Accession Q86WN2 IFN-epsilon
Symbols IFN-E
IFNE1
IFNT1
INFE1
PRO655

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQ      1 - 70
QYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNL     71 - 140
RLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR      141 - 208
//

Text Mined References (18)

PMID Year Title