Property Summary

NCBI Gene PubMed Count 7
PubMed Score 12.50
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
20307617 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELPAATADLDLSH      1 - 70
NALQRLRPGWLAPLFQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNTLRALGRHDLDGLGALEKLLL     71 - 140
FNNRLVHLDEHAFHGLRALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFL    141 - 210
KNGLYLHNNPLPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALG    211 - 280
LERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLF    281 - 350
VCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWP    351 - 420
QTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYNPGGLQLKAGS    421 - 490
ESASSIGSEGPMTT                                                            491 - 504
//

Publication (7)

PMID Year Title
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20307617 2010 Association analysis of 3p21 with Crohn's disease in a New Zealand population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12629050 2003 AMIGO, a transmembrane protein implicated in axon tract development, defines a novel protein family with leucine-rich repeats.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.