Property Summary

NCBI Gene PubMed Count 8
PubMed Score 49.86
PubTator Score 31.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.0444929799132E-10
pilocytic astrocytoma 3086 1.61145727103554E-10
sonic hedgehog group medulloblastoma 1482 1.81126644969752E-9
pediatric high grade glioma 2712 3.71078566577555E-8
glioblastoma 5572 4.21750020130441E-7
medulloblastoma, large-cell 6234 1.31085653320541E-6
sarcoidosis 368 2.50091545380992E-6
primitive neuroectodermal tumor 3031 9.70635409992486E-6
pituitary cancer 1972 2.84500446718681E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.77251836148187E-4
osteosarcoma 7933 9.99048248069226E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00167291982157958
astrocytic glioma 2241 0.00177090785657569
ependymoma 2514 0.0030591592281454
oligodendroglioma 2849 0.00617886042799897
subependymal giant cell astrocytoma 2287 0.0337637355041165

Expression

Synonym

Accession Q86WK6 B4DIM3 Q8IW71 Q9ULQ7
Symbols ALI2
AMIGO
AMIGO-1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
26240432 AMIGO1 is identified as a candidate gene for human schizophrenia and related psychiatric disorders.

AA Sequence

MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSH      1 - 70
NNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLL     71 - 140
LYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPA    141 - 210
WIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEA    211 - 280
HLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNE    281 - 350
TLSVELKVHNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS    351 - 420
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTP    421 - 490
IVV                                                                       491 - 493
//

Text Mined References (10)

PMID Year Title
26240432 2016 AMIGO-Kv2.1 Potassium Channel Complex Is Associated With Schizophrenia-Related Phenotypes.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12629050 2003 AMIGO, a transmembrane protein implicated in axon tract development, defines a novel protein family with leucine-rich repeats.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.