Property Summary

NCBI Gene PubMed Count 40
PubMed Score 176.75
PubTator Score 88.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.100 8.0e-03
atypical teratoid / rhabdoid tumor 1.300 1.2e-04
intraductal papillary-mucinous adenoma (... 1.100 3.2e-03
intraductal papillary-mucinous carcinoma... 1.100 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 4.8e-03
lung cancer 1.800 4.6e-04
medulloblastoma, large-cell 1.700 1.9e-04
osteosarcoma -1.197 7.0e-03
ovarian cancer 2.000 4.3e-07
psoriasis -1.700 7.6e-05

Gene RIF (26)

AA Sequence

MERAGATSRGGQAPGFLLRLHTEGRAEAARVQEQDLRQWGLTGIHLRSYQLEGVNWLAQRFHCQNGCILG      1 - 70
DEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPGLSCVTYAGDKEERACLQQDL     71 - 140
KQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSL    141 - 210
QELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYH    211 - 280
GMSALQKKYYKAILMKDLDAFENETAKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLH    281 - 350
LLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQQPIFVFLLS    351 - 420
TRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLT    421 - 490
NMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGSTMDEIDLESILGETKDGQWVSDALPAAEG    491 - 560
GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTK    561 - 630
RKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENG    631 - 700
EESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAG    701 - 770
KMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHL    771 - 840
PRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP                 841 - 897
//

Text Mined References (49)

PMID Year Title