Property Summary

NCBI Gene PubMed Count 38
PubMed Score 63.62
PubTator Score 27.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.426 8.6e-03
adult high grade glioma 1.400 1.4e-03
Astrocytoma, Pilocytic 1.400 8.2e-07
cystic fibrosis 1.100 1.9e-02
glioblastoma 1.100 2.8e-04
interstitial cystitis 2.500 6.6e-04
intraductal papillary-mucinous carcinoma... 1.200 4.6e-02
intraductal papillary-mucinous neoplasm ... 1.900 1.9e-02
invasive ductal carcinoma 1.176 1.1e-03
juvenile dermatomyositis 1.650 6.3e-15
lung carcinoma -1.200 2.0e-12
osteosarcoma -3.789 1.9e-07
ovarian cancer 1.700 2.0e-04
pituitary cancer -1.900 1.4e-06
posterior fossa group A ependymoma 1.100 5.9e-06
primary Sjogren syndrome 2.100 1.0e-04
subependymal giant cell astrocytoma 2.324 6.0e-03

Gene RIF (29)

AA Sequence

MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQ      1 - 70
SFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQ     71 - 140
LELAKKYLQLLRTSAQQRYRSQIPGSGQPHAFHQVYVPPILRRATASLDTPEGAIMGDVKVEDGADVSIS    141 - 210
DLFNTRVNKGPRVTVLLGKAGMGKTTLAHRLCQKWAEGHLNCFQALFLFEFRQLNLITRFLTPSELLFDL    211 - 280
YLSPESDHDTVFQYLEKNADQVLLIFDGLDEALQPMGPDGPGPVLTLFSHLCNGTLLPGCRVMATSRPGK    281 - 350
LPACLPAEAAMVHMLGFDGPRVEEYVNHFFSAQPSREGALVELQTNGRLRSLCAVPALCQVACLCLHHLL    351 - 420
PDHAPGQSVALLPNMTQLYMQMVLALSPPGHLPTSSLLDLGEVALRGLETGKVIFYAKDIAPPLIAFGAT    421 - 490
HSLLTSFCVCTGPGHQQTGYAFTHLSLQEFLAALHLMASPKVNKDTLTQYVTLHSRWVQRTKARLGLSDH    491 - 560
LPTFLAGLASCTCRPFLSHLAQGNEDCVGAKQAAVVQVLKKLATRKLTGPKVVELCHCVDETQEPELASL    561 - 630
TAQSLPYQLPFHNFPLTCTDLATLTNILEHREAPIHLDFDGCPLEPHCPEALVGCGQIENLSFKSRKCGD    631 - 700
AFAEALSRSLPTMGRLQMLGLAGSKITARGISHLVKALPLCPQLKEVSFRDNQLSDQVVLNIVEVLPHLP    701 - 770
RLRKLDLSSNSICVSTLLCLARVAVTCPTVRMLQAREADLIFLLSPPTETTAELQRAPDLQESDGQRKGA    771 - 840
QSRSLTLRLQKCQLQVHDAEALIALLQEGPHLEEVDLSGNQLEDEGCRLMAEAASQLHIARKLDLSNNGL    841 - 910
SVAGVHCVLRAVSACWTLAELHISLQHKTVIFMFAQEPEEQKGPQERAAFLDSLMLQMPSELPLSSRRMR    911 - 980
LTHCGLQEKHLEQLCKALGGSCHLGHLHLDFSGNALGDEGAARLAQLLPGLGALQSLNLSENGLSLDAVL    981 - 1050
GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLE   1051 - 1120
PPSLTRLCATLKDCPGPLELQLSCEFLSDQSLETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLC   1121 - 1190
PRVKKVDLRSLHHATLHFRSNEEEEGVCCGRFTGCSLSQEHVESLCWLLSKCKDLSQVDLSANLLGDSGL   1191 - 1260
RCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSCPRVREASVNLGSEQSFRIHFSREDQAGKTLRL   1261 - 1330
SECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQLAILLSLVGRPAGLFSLRVQEPWADRARVLSLL   1331 - 1400
EVCAQASGSVTEISISETQQQLCVQLEFPRQEENPEAVALRLAHCDLGAHHSLLVGQLMETCARLQQLSL   1401 - 1470
SQVNLCEDDDASSLLLQSLLLSLSELKTFRLTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQFDEEGTK   1471 - 1540
ALMRALEGKWMLKRLDLSHLLLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDVGCCHLSEALRAATSLEE   1541 - 1610
LDLSHNQIGDAGVQHLATILPGLPELRKIDLSGNSISSAGGVQLAESLVLCRRLEELMLGCNALGDPTAL   1611 - 1680
GLAQELPQHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELPLLRQIDLVSC   1681 - 1750
KIDNQTAKLLTSSFTSCPALEVILLSWNLLGDEAAAELAQVLPQMGRLKRVDLEKNQITALGAWLLAEGL   1751 - 1820
AQGSSIQVIRLWNNPIPCDMAQHLKSQEPRLDFAFFDNQPQAPWGT                           1821 - 1866
//

Text Mined References (43)

PMID Year Title