Property Summary

NCBI Gene PubMed Count 31
Grant Count 16
R01 Count 10
Funding $1,362,473.52
PubMed Score 50.90
PubTator Score 27.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
26620909 NLRC5 function is shaped by reversible ubiquitination, which modulates the NF-kappaB activation switch
26592197 NLRC5 regulates TGFB1-induced proliferation and activation of hepatic stellate cells during hepatic fibrosis.
25972545 RSV infection of lung epithelial cells induces expression of RIG-I, NLRC5, and subsequent upregulation of HLA-A, HLA-B and HLA-C.
25820389 In a transformed cell line, NLRC5 plays a significant role in IL-6 and IL-1Beta secretion.
25404059 a novel role for NLRC5 in RIG-I-mediated antiviral host responses against influenza virus infection, distinguished from the role of NLRC5 in MHC class I gene regulation.
25127861 This study presents a detailed functional study of the domains of NLRC5 revealing that the N-terminal domain of human NLRC5 has intrinsic transcriptional activity.
24815518 Unusual structural features revealed by the solution NMR structure of the NLRC5 caspase recruitment domain.
24044430 A model for full-length human NLRC5 was prepared and, besides the closed conformation of monomeric NLRC5, a heptameric platform was also modeled for the opened conformational NLRC5 monomers.
23815151 rhinovirus ion channel protein 2B triggers NLRP3 and NLRC5 inflammasome activation and IL-1beta secretion in bronchial cells
22490869 NLRC5 can cooperate with X1 box-binding transcription factor RFX and X2 box-binding transcription factor ATF1 in activation of histocompatibility class I promoter region.
More...

AA Sequence

MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQ      1 - 70
SFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQ     71 - 140
LELAKKYLQLLRTSAQQRYRSQIPGSGQPHAFHQVYVPPILRRATASLDTPEGAIMGDVKVEDGADVSIS    141 - 210
DLFNTRVNKGPRVTVLLGKAGMGKTTLAHRLCQKWAEGHLNCFQALFLFEFRQLNLITRFLTPSELLFDL    211 - 280
YLSPESDHDTVFQYLEKNADQVLLIFDGLDEALQPMGPDGPGPVLTLFSHLCNGTLLPGCRVMATSRPGK    281 - 350
LPACLPAEAAMVHMLGFDGPRVEEYVNHFFSAQPSREGALVELQTNGRLRSLCAVPALCQVACLCLHHLL    351 - 420
PDHAPGQSVALLPNMTQLYMQMVLALSPPGHLPTSSLLDLGEVALRGLETGKVIFYAKDIAPPLIAFGAT    421 - 490
HSLLTSFCVCTGPGHQQTGYAFTHLSLQEFLAALHLMASPKVNKDTLTQYVTLHSRWVQRTKARLGLSDH    491 - 560
LPTFLAGLASCTCRPFLSHLAQGNEDCVGAKQAAVVQVLKKLATRKLTGPKVVELCHCVDETQEPELASL    561 - 630
TAQSLPYQLPFHNFPLTCTDLATLTNILEHREAPIHLDFDGCPLEPHCPEALVGCGQIENLSFKSRKCGD    631 - 700
AFAEALSRSLPTMGRLQMLGLAGSKITARGISHLVKALPLCPQLKEVSFRDNQLSDQVVLNIVEVLPHLP    701 - 770
RLRKLDLSSNSICVSTLLCLARVAVTCPTVRMLQAREADLIFLLSPPTETTAELQRAPDLQESDGQRKGA    771 - 840
QSRSLTLRLQKCQLQVHDAEALIALLQEGPHLEEVDLSGNQLEDEGCRLMAEAASQLHIARKLDLSNNGL    841 - 910
SVAGVHCVLRAVSACWTLAELHISLQHKTVIFMFAQEPEEQKGPQERAAFLDSLMLQMPSELPLSSRRMR    911 - 980
LTHCGLQEKHLEQLCKALGGSCHLGHLHLDFSGNALGDEGAARLAQLLPGLGALQSLNLSENGLSLDAVL    981 - 1050
GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLE   1051 - 1120
PPSLTRLCATLKDCPGPLELQLSCEFLSDQSLETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLC   1121 - 1190
PRVKKVDLRSLHHATLHFRSNEEEEGVCCGRFTGCSLSQEHVESLCWLLSKCKDLSQVDLSANLLGDSGL   1191 - 1260
RCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSCPRVREASVNLGSEQSFRIHFSREDQAGKTLRL   1261 - 1330
SECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQLAILLSLVGRPAGLFSLRVQEPWADRARVLSLL   1331 - 1400
EVCAQASGSVTEISISETQQQLCVQLEFPRQEENPEAVALRLAHCDLGAHHSLLVGQLMETCARLQQLSL   1401 - 1470
SQVNLCEDDDASSLLLQSLLLSLSELKTFRLTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQFDEEGTK   1471 - 1540
ALMRALEGKWMLKRLDLSHLLLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDVGCCHLSEALRAATSLEE   1541 - 1610
LDLSHNQIGDAGVQHLATILPGLPELRKIDLSGNSISSAGGVQLAESLVLCRRLEELMLGCNALGDPTAL   1611 - 1680
GLAQELPQHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELPLLRQIDLVSC   1681 - 1750
KIDNQTAKLLTSSFTSCPALEVILLSWNLLGDEAAAELAQVLPQMGRLKRVDLEKNQITALGAWLLAEGL   1751 - 1820
AQGSSIQVIRLWNNPIPCDMAQHLKSQEPRLDFAFFDNQPQAPWGT                           1821 - 1866
//

Text Mined References (36)

PMID Year Title
26620909 2015 Reversible ubiquitination shapes NLRC5 function and modulates NF-?B activation switch.
26592197 2016 NLRC5 regulates TGF-?1-induced proliferation and activation of hepatic stellate cells during hepatic fibrosis.
25972545 2015 Respiratory Syncytial Virus Infection Upregulates NLRC5 and Major Histocompatibility Complex Class I Expression through RIG-I Induction in Airway Epithelial Cells.
25820389 2015 NLRC5 Mediates IL-6 and IL-1? Secretion in LX-2 Cells and Modulated by the NF-?B/Smad3 Pathway.
25404059 2015 NLRC5 interacts with RIG-I to induce a robust antiviral response against influenza virus infection.
25127861 2014 The N-terminal domain of NLRC5 confers transcriptional activity for MHC class I and II gene expression.
24815518 2014 Unusual structural features revealed by the solution NMR structure of the NLRC5 caspase recruitment domain.
24044430 2013 A molecular model of the full-length human NOD-like receptor family CARD domain containing 5 (NLRC5) protein.
23815151 2013 Rhinovirus-induced calcium flux triggers NLRP3 and NLRC5 activation in bronchial cells.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
More...