Property Summary

NCBI Gene PubMed Count 31
PubMed Score 50.90
PubTator Score 27.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
glioblastoma multiforme 347 4.23349762490937E-17
juvenile dermatomyositis 1189 6.26985741220954E-15
lung carcinoma 2844 2.0131554698241E-12
osteosarcoma 7933 1.85506916022734E-7
pilocytic astrocytoma 3086 1.90289746400752E-7
pituitary cancer 1972 1.44884964632983E-6
posterior fossa group A ependymoma 1511 5.93050472525677E-6
primary Sjogren syndrome 789 1.00059591671931E-4
ovarian cancer 8492 2.00178894898724E-4
interstitial cystitis 2299 6.5740080921358E-4
invasive ductal carcinoma 2950 0.001134534916617
adult high grade glioma 2148 0.00138779919864474
subependymal giant cell astrocytoma 2287 0.00601141479489843
active Crohn's disease 918 0.00857497025876696
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0185096856945501
cystic fibrosis 1670 0.0187365834708484
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0459995903965595
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Endometritis 21 3.108 1.6

Expression

Synonym

Accession Q86WI3 B5MEF1 C9JMD8 Q6P4A6 Q86VM7 Q8NF42 Q8TEE2 Q8TEJ1 Q969L7
Symbols NOD4
NOD27
CLR16.1

Gene

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG

Gene RIF (22)

PMID Text
26620909 NLRC5 function is shaped by reversible ubiquitination, which modulates the NF-kappaB activation switch
26592197 NLRC5 regulates TGFB1-induced proliferation and activation of hepatic stellate cells during hepatic fibrosis.
25972545 RSV infection of lung epithelial cells induces expression of RIG-I, NLRC5, and subsequent upregulation of HLA-A, HLA-B and HLA-C.
25820389 In a transformed cell line, NLRC5 plays a significant role in IL-6 and IL-1Beta secretion.
25404059 a novel role for NLRC5 in RIG-I-mediated antiviral host responses against influenza virus infection, distinguished from the role of NLRC5 in MHC class I gene regulation.
25127861 This study presents a detailed functional study of the domains of NLRC5 revealing that the N-terminal domain of human NLRC5 has intrinsic transcriptional activity.
24815518 Unusual structural features revealed by the solution NMR structure of the NLRC5 caspase recruitment domain.
24044430 A model for full-length human NLRC5 was prepared and, besides the closed conformation of monomeric NLRC5, a heptameric platform was also modeled for the opened conformational NLRC5 monomers.
23815151 rhinovirus ion channel protein 2B triggers NLRP3 and NLRC5 inflammasome activation and IL-1beta secretion in bronchial cells
22490869 NLRC5 can cooperate with X1 box-binding transcription factor RFX and X2 box-binding transcription factor ATF1 in activation of histocompatibility class I promoter region.
More...

AA Sequence

MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQ      1 - 70
SFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQ     71 - 140
LELAKKYLQLLRTSAQQRYRSQIPGSGQPHAFHQVYVPPILRRATASLDTPEGAIMGDVKVEDGADVSIS    141 - 210
DLFNTRVNKGPRVTVLLGKAGMGKTTLAHRLCQKWAEGHLNCFQALFLFEFRQLNLITRFLTPSELLFDL    211 - 280
YLSPESDHDTVFQYLEKNADQVLLIFDGLDEALQPMGPDGPGPVLTLFSHLCNGTLLPGCRVMATSRPGK    281 - 350
LPACLPAEAAMVHMLGFDGPRVEEYVNHFFSAQPSREGALVELQTNGRLRSLCAVPALCQVACLCLHHLL    351 - 420
PDHAPGQSVALLPNMTQLYMQMVLALSPPGHLPTSSLLDLGEVALRGLETGKVIFYAKDIAPPLIAFGAT    421 - 490
HSLLTSFCVCTGPGHQQTGYAFTHLSLQEFLAALHLMASPKVNKDTLTQYVTLHSRWVQRTKARLGLSDH    491 - 560
LPTFLAGLASCTCRPFLSHLAQGNEDCVGAKQAAVVQVLKKLATRKLTGPKVVELCHCVDETQEPELASL    561 - 630
TAQSLPYQLPFHNFPLTCTDLATLTNILEHREAPIHLDFDGCPLEPHCPEALVGCGQIENLSFKSRKCGD    631 - 700
AFAEALSRSLPTMGRLQMLGLAGSKITARGISHLVKALPLCPQLKEVSFRDNQLSDQVVLNIVEVLPHLP    701 - 770
RLRKLDLSSNSICVSTLLCLARVAVTCPTVRMLQAREADLIFLLSPPTETTAELQRAPDLQESDGQRKGA    771 - 840
QSRSLTLRLQKCQLQVHDAEALIALLQEGPHLEEVDLSGNQLEDEGCRLMAEAASQLHIARKLDLSNNGL    841 - 910
SVAGVHCVLRAVSACWTLAELHISLQHKTVIFMFAQEPEEQKGPQERAAFLDSLMLQMPSELPLSSRRMR    911 - 980
LTHCGLQEKHLEQLCKALGGSCHLGHLHLDFSGNALGDEGAARLAQLLPGLGALQSLNLSENGLSLDAVL    981 - 1050
GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLE   1051 - 1120
PPSLTRLCATLKDCPGPLELQLSCEFLSDQSLETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLC   1121 - 1190
PRVKKVDLRSLHHATLHFRSNEEEEGVCCGRFTGCSLSQEHVESLCWLLSKCKDLSQVDLSANLLGDSGL   1191 - 1260
RCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSCPRVREASVNLGSEQSFRIHFSREDQAGKTLRL   1261 - 1330
SECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQLAILLSLVGRPAGLFSLRVQEPWADRARVLSLL   1331 - 1400
EVCAQASGSVTEISISETQQQLCVQLEFPRQEENPEAVALRLAHCDLGAHHSLLVGQLMETCARLQQLSL   1401 - 1470
SQVNLCEDDDASSLLLQSLLLSLSELKTFRLTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQFDEEGTK   1471 - 1540
ALMRALEGKWMLKRLDLSHLLLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDVGCCHLSEALRAATSLEE   1541 - 1610
LDLSHNQIGDAGVQHLATILPGLPELRKIDLSGNSISSAGGVQLAESLVLCRRLEELMLGCNALGDPTAL   1611 - 1680
GLAQELPQHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELPLLRQIDLVSC   1681 - 1750
KIDNQTAKLLTSSFTSCPALEVILLSWNLLGDEAAAELAQVLPQMGRLKRVDLEKNQITALGAWLLAEGL   1751 - 1820
AQGSSIQVIRLWNNPIPCDMAQHLKSQEPRLDFAFFDNQPQAPWGT                           1821 - 1866
//

Text Mined References (36)

PMID Year Title
26620909 2015 Reversible ubiquitination shapes NLRC5 function and modulates NF-?B activation switch.
26592197 2016 NLRC5 regulates TGF-?1-induced proliferation and activation of hepatic stellate cells during hepatic fibrosis.
25972545 2015 Respiratory Syncytial Virus Infection Upregulates NLRC5 and Major Histocompatibility Complex Class I Expression through RIG-I Induction in Airway Epithelial Cells.
25820389 2015 NLRC5 Mediates IL-6 and IL-1? Secretion in LX-2 Cells and Modulated by the NF-?B/Smad3 Pathway.
25404059 2015 NLRC5 interacts with RIG-I to induce a robust antiviral response against influenza virus infection.
25127861 2014 The N-terminal domain of NLRC5 confers transcriptional activity for MHC class I and II gene expression.
24815518 2014 Unusual structural features revealed by the solution NMR structure of the NLRC5 caspase recruitment domain.
24044430 2013 A molecular model of the full-length human NOD-like receptor family CARD domain containing 5 (NLRC5) protein.
23815151 2013 Rhinovirus-induced calcium flux triggers NLRP3 and NLRC5 activation in bronchial cells.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
More...