Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.000 1.4e-02
ependymoma -2.100 2.5e-02
gastric cancer 1.300 5.9e-03
group 4 medulloblastoma -1.300 2.4e-02
intraductal papillary-mucinous adenoma (... 1.200 4.3e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.4e-02
lung adenocarcinoma -1.100 1.2e-09
lung carcinoma -2.400 4.0e-37
non-small cell lung cancer -1.176 3.7e-16
oligodendroglioma -1.700 3.0e-02
osteosarcoma -1.979 6.3e-04
ovarian cancer -2.800 1.0e-09
pancreatic cancer 1.100 1.9e-02
pancreatic carcinoma 1.100 1.9e-02
Pick disease 1.300 2.3e-04
pituitary cancer 2.000 1.9e-04
primary pancreatic ductal adenocarcinoma 1.034 8.7e-03
subependymal giant cell astrocytoma 1.837 1.8e-02

Gene RIF (7)

AA Sequence

MSSGYSSLEEDAEDFFFTARTSFFRRAPQGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLK      1 - 70
MTLNSNGIYTGFIKVQMELCKPPQTSPNSGKLSPSSNGCMNTLHISSTNTVGEVIEALLKKFLVTESPAK     71 - 140
FALYKRCHREDQVYACKLSDREHPLYLRLVAGPRTDTLSFVLREHEIGEWEAFSLPELQNFLRILDKEED    141 - 210
EQLQNLKRRYTAYRQKLEEALREVWKPD                                              211 - 238
//

Text Mined References (16)

PMID Year Title