Property Summary

NCBI Gene PubMed Count 14
PubMed Score 88.38
PubTator Score 21.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.500 4.5e-05
osteosarcoma 2.613 3.4e-11
ovarian cancer 1.400 1.3e-11

Gene RIF (8)

AA Sequence

MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFF      1 - 70
SPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKK     71 - 140
ELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKA    141 - 210
KWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMR    211 - 280
QLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSK    281 - 350
ATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS       351 - 417
//

Text Mined References (16)

PMID Year Title