Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.08
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 9.5724213789633E-6
diabetes mellitus 1663 0.0199916553147931

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.392 0.000
diabetes mellitus -1.400 0.020

Synonym

Accession Q86WC6
Symbols DYSFIP1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHE      1 - 70
AVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPD     71 - 140
YKELVELFKGTTMD                                                            141 - 154
//

Text Mined References (5)

PMID Year Title
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.