Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.08
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.6e-06
diabetes mellitus 1728 2.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.400 2.0e-02
osteosarcoma 1.392 9.6e-06

AA Sequence

MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHE      1 - 70
AVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPD     71 - 140
YKELVELFKGTTMD                                                            141 - 154
//

Text Mined References (5)

PMID Year Title