Property Summary

NCBI Gene PubMed Count 23
PubMed Score 130.56
PubTator Score 50.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.18284270074498E-6
group 3 medulloblastoma 2254 4.69156708935043E-5
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Disease Target Count Z-score Confidence
Angelman syndrome 38 3.077 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
group 3 medulloblastoma 1.300 0.000

Synonym

Accession Q86WB0 A6NH66 Q75MF3 Q75MF4 Q8N330 Q96F75 Q9HA34 Q9NVX4 Q9P0R0
Symbols NIPA
HSPC216

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26266351 ZC3HC1 rs11556924 polymorphism is associated with hypertension in a Finnish cohort.
24286297 Results indicate that ZC3HC1 rs11556924 polymorphism is associated with subclinical atherosclerosis in rheumatoid arthritis.
22955283 Data show that cell cycle-dependent phosphorylation of nuclear interaction partner of anaplastic lymphoma kinase (NIPA)is mediated by extracellular signal-regulated kinase 2 (ERK2).
22205987 phosphorylated NIPA is degraded in late mitosis in an APC/C(Cdh1)-dependent manner
16009132 The NIPA protein is a human F-box-containing protein that defines an SCF-type E3 ligase (SCF(NIPA)) controlling mitotic entry.
12748172 NIPA has an antiapoptotic role in NPM-ALK-mediated signaling events

AA Sequence

MAAPCEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSL      1 - 70
ESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWVTVECDMLKCSSCQAFLCASLQPAFDFDRYKQR     71 - 140
CAELKKALCTAHEKFCFWPDSPSPDRFGMLPLDEPAILVSEFLDRFQSLCHLDLQLPSLRPEDLKTMCLT    141 - 210
EDKISLLLHLLEDELDHRTDERKTTIKLGSDIQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVG    211 - 280
LWGFQQIESSMTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVS    281 - 350
RTRSWDSSSPVDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFD    351 - 420
PTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSMSLSEKSRKVF    421 - 490
RIFRQWESLCSC                                                              491 - 502
//

Text Mined References (34)

PMID Year Title
26266351 2015 Association of Zinc Finger, C3HC-Type Containing 1 (ZC3HC1) rs11556924 Genetic Variant With Hypertension in a Finnish Population, the TAMRISK Study.
24286297 2013 The ZC3HC1 rs11556924 polymorphism is associated with increased carotid intima-media thickness in patients with rheumatoid arthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22955283 2012 Extracellular signal-regulated kinase 2 (ERK2) mediates phosphorylation and inactivation of nuclear interaction partner of anaplastic lymphoma kinase (NIPA) at G2/M.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22205987 2011 APC/C(Cdh1)-mediated degradation of the F-box protein NIPA is regulated by its association with Skp1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
More...