Property Summary

NCBI Gene PubMed Count 25
PubMed Score 136.04
PubTator Score 50.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 2.2e-06
group 3 medulloblastoma 4104 4.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Angelman syndrome 34 3.077 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.2e-06
group 3 medulloblastoma 1.300 4.7e-05

Protein-protein Interaction (5)

Gene RIF (8)

AA Sequence

MAAPCEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSL      1 - 70
ESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWVTVECDMLKCSSCQAFLCASLQPAFDFDRYKQR     71 - 140
CAELKKALCTAHEKFCFWPDSPSPDRFGMLPLDEPAILVSEFLDRFQSLCHLDLQLPSLRPEDLKTMCLT    141 - 210
EDKISLLLHLLEDELDHRTDERKTTIKLGSDIQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVG    211 - 280
LWGFQQIESSMTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVS    281 - 350
RTRSWDSSSPVDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFD    351 - 420
PTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSMSLSEKSRKVF    421 - 490
RIFRQWESLCSC                                                              491 - 502
//

Text Mined References (36)

PMID Year Title