Property Summary

NCBI Gene PubMed Count 23
Grant Count 9
R01 Count 4
Funding $2,307,035.5
PubMed Score 130.56
PubTator Score 50.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
group 3 medulloblastoma 1.300 0.000

Gene RIF (6)

PMID Text
26266351 ZC3HC1 rs11556924 polymorphism is associated with hypertension in a Finnish cohort.
24286297 Results indicate that ZC3HC1 rs11556924 polymorphism is associated with subclinical atherosclerosis in rheumatoid arthritis.
22955283 Data show that cell cycle-dependent phosphorylation of nuclear interaction partner of anaplastic lymphoma kinase (NIPA)is mediated by extracellular signal-regulated kinase 2 (ERK2).
22205987 phosphorylated NIPA is degraded in late mitosis in an APC/C(Cdh1)-dependent manner
16009132 The NIPA protein is a human F-box-containing protein that defines an SCF-type E3 ligase (SCF(NIPA)) controlling mitotic entry.
12748172 NIPA has an antiapoptotic role in NPM-ALK-mediated signaling events

AA Sequence

MAAPCEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSL      1 - 70
ESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWVTVECDMLKCSSCQAFLCASLQPAFDFDRYKQR     71 - 140
CAELKKALCTAHEKFCFWPDSPSPDRFGMLPLDEPAILVSEFLDRFQSLCHLDLQLPSLRPEDLKTMCLT    141 - 210
EDKISLLLHLLEDELDHRTDERKTTIKLGSDIQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVG    211 - 280
LWGFQQIESSMTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVS    281 - 350
RTRSWDSSSPVDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFD    351 - 420
PTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSMSLSEKSRKVF    421 - 490
RIFRQWESLCSC                                                              491 - 502
//

Publication (34)

PMID Year Title
26266351 2015 Association of Zinc Finger, C3HC-Type Containing 1 (ZC3HC1) rs11556924 Genetic Variant With Hypertension in a Finnish Population, the TAMRISK Study.
24286297 2013 The ZC3HC1 rs11556924 polymorphism is associated with increased carotid intima-media thickness in patients with rheumatoid arthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22955283 2012 Extracellular signal-regulated kinase 2 (ERK2) mediates phosphorylation and inactivation of nuclear interaction partner of anaplastic lymphoma kinase (NIPA) at G2/M.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22205987 2011 APC/C(Cdh1)-mediated degradation of the F-box protein NIPA is regulated by its association with Skp1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
More...