Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.48
PubTator Score 6.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.500 0.000
Pick disease -1.300 0.000
ovarian cancer -1.400 0.000

Synonym

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
21752829 SLC26A11 protein localizes in lysosomes in HeLa cells

AA Sequence

MPSSVTALGQARSSGPGMAPSACCCSPAALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYA      1 - 70
EVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEPAYAVLLAFLSGCIQLAMGVL     71 - 140
RLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCML    141 - 210
LLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGL    211 - 280
PPVRIPPFSVTTANGTISFTEMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNM    281 - 350
LGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD    351 - 420
TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLS    421 - 490
FPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLL    491 - 560
SADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQKVALLKA                            561 - 606
//

Text Mined References (15)

PMID Year Title
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
22521418 2012 PSORS2 is due to mutations in CARD14.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
20957757 2010 The proteome of lysosomes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17897319 2007 Integral and associated lysosomal membrane proteins.
17693766 2007 Renal physiology of SLC26 anion exchangers.
17071331 2006 SLC26 chloride/base exchangers in the kidney in health and disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...