Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.87
PubTator Score 6.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.500 2.7e-04
ovarian cancer -1.400 8.6e-07
Pick disease -1.300 3.5e-06

Gene RIF (1)

AA Sequence

MPSSVTALGQARSSGPGMAPSACCCSPAALQRRLPILAWLPSYSLQWLKMDFVAGLSVGLTAIPQALAYA      1 - 70
EVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEPAYAVLLAFLSGCIQLAMGVL     71 - 140
RLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETRVGDAVLGLVCML    141 - 210
LLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGL    211 - 280
PPVRIPPFSVTTANGTISFTEMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNM    281 - 350
LGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD    351 - 420
TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLS    421 - 490
FPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLL    491 - 560
SADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQKVALLKA                            561 - 606
//

Text Mined References (15)

PMID Year Title