Property Summary

NCBI Gene PubMed Count 7
Grant Count 8
Funding $778,616.33
PubMed Score 3.84
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytoma 1.300 0.019
ependymoma -1.100 0.029
oligodendroglioma 1.300 0.012
psoriasis -2.000 0.000
cutaneous lupus erythematosus -1.200 0.006
osteosarcoma -2.164 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.200 0.006
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.300 0.004
pancreatic ductal adenocarcinoma liver m... -3.060 0.003
non-small cell lung cancer -1.418 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.007
colon cancer -1.700 0.048
lung cancer -2.400 0.002
invasive ductal carcinoma -1.100 0.010
ovarian cancer -2.700 0.000

Gene RIF (2)

PMID Text
22002062 The proteolytic activity of oligomeric Tysnd1 is in turn controlled by self-cleavage of Tysnd1 and degradation of Tysnd1 cleavage products by PsLon.
15870080 Lon recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites of MPPalpha and StAR, and generates unfolded polypeptides that are then processively degraded

AA Sequence

MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVIPNTPDPASDA      1 - 70
QDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMR     71 - 140
EELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPREALPDILTSIIRTSNKEKLQILDAVSLEER    141 - 210
FKMTIPLLVRQIEGLKLLQKTRKPKQDDDKRVIAIRPIRRITHISGTLEDEDEDEDNDDIVMLEKKIRTS    211 - 280
SMPEQAHKVCVKEIKRLKKMPQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLK    281 - 350
KRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGS    351 - 420
MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDLSQVLFIAT    421 - 490
ANTTATIPAALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGLTPQQIQIPQVTTLDIITRYTREAG    491 - 560
VRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGCREHILEDEKPESISDTTDLALPPEMPILID    561 - 630
FHALKDILGPPMYEMEVSQRLSQPGVAIGLAWTPLGGEIMFVEASRMDGEGQLTLTGQLGDVMKESAHLA    631 - 700
ISWLRSNAKKYQLTNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGE    701 - 770
ITLRGLVLPVGGIKDKVLAAHRAGLKQVIIPRRNEKDLEGIPGNVRQDLSFVTASCLDEVLNAAFDGGFT    771 - 840
VKTRPGLLNSKL                                                              841 - 852
//

Text Mined References (12)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22002062 2011 Two proteases, trypsin domain-containing 1 (Tysnd1) and peroxisomal lon protease (PsLon), cooperatively regulate fatty acid ?-oxidation in peroxisomal matrix.
21269460 2011 Initial characterization of the human central proteome.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19946888 2010 Defining the membrane proteome of NK cells.
18281296 2008 Contribution of peroxisome-specific isoform of Lon protease in sorting PTS1 proteins to peroxisomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...