Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.84
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 6.10883009116814E-17
ovarian cancer 8492 8.50848619185628E-11
malignant mesothelioma 3163 1.12069428143686E-5
medulloblastoma 1524 3.81672796629248E-5
atypical teratoid / rhabdoid tumor 4369 7.85031025825277E-5
medulloblastoma, large-cell 6234 8.65922382931441E-5
osteosarcoma 7933 1.26775045733958E-4
psoriasis 6685 3.67406858950592E-4
lung cancer 4473 0.00172584447953851
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00264151031837524
primitive neuroectodermal tumor 3031 0.0035125901698874
glioblastoma 5572 0.00572638148547424
cutaneous lupus erythematosus 1056 0.0059150549957767
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00742891523227503
invasive ductal carcinoma 2950 0.00975053966937755
oligodendroglioma 2849 0.0117909678794974
astrocytoma 1493 0.0185328753656093
ependymoma 2514 0.0285268225708902
colon cancer 1475 0.0477111192563626

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytoma 1.300 0.019
ependymoma -1.100 0.029
oligodendroglioma 1.300 0.012
psoriasis -2.000 0.000
cutaneous lupus erythematosus -1.200 0.006
osteosarcoma -2.164 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.200 0.006
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.300 0.004
pancreatic ductal adenocarcinoma liver m... -3.060 0.003
non-small cell lung cancer -1.418 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.007
colon cancer -1.700 0.048
lung cancer -2.400 0.002
invasive ductal carcinoma -1.100 0.010
ovarian cancer -2.700 0.000

Synonym

Accession Q86WA8 B7ZKL7 Q0D2H6 Q8N3B9 Q8NCE9 Q96K43
Symbols LONP
LONPL

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (2)

PMID Text
22002062 The proteolytic activity of oligomeric Tysnd1 is in turn controlled by self-cleavage of Tysnd1 and degradation of Tysnd1 cleavage products by PsLon.
15870080 Lon recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites of MPPalpha and StAR, and generates unfolded polypeptides that are then processively degraded

AA Sequence

MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVIPNTPDPASDA      1 - 70
QDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMR     71 - 140
EELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPREALPDILTSIIRTSNKEKLQILDAVSLEER    141 - 210
FKMTIPLLVRQIEGLKLLQKTRKPKQDDDKRVIAIRPIRRITHISGTLEDEDEDEDNDDIVMLEKKIRTS    211 - 280
SMPEQAHKVCVKEIKRLKKMPQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLK    281 - 350
KRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGS    351 - 420
MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDLSQVLFIAT    421 - 490
ANTTATIPAALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGLTPQQIQIPQVTTLDIITRYTREAG    491 - 560
VRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGCREHILEDEKPESISDTTDLALPPEMPILID    561 - 630
FHALKDILGPPMYEMEVSQRLSQPGVAIGLAWTPLGGEIMFVEASRMDGEGQLTLTGQLGDVMKESAHLA    631 - 700
ISWLRSNAKKYQLTNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGE    701 - 770
ITLRGLVLPVGGIKDKVLAAHRAGLKQVIIPRRNEKDLEGIPGNVRQDLSFVTASCLDEVLNAAFDGGFT    771 - 840
VKTRPGLLNSKL                                                              841 - 852
//

Text Mined References (12)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22002062 2011 Two proteases, trypsin domain-containing 1 (Tysnd1) and peroxisomal lon protease (PsLon), cooperatively regulate fatty acid ?-oxidation in peroxisomal matrix.
21269460 2011 Initial characterization of the human central proteome.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19946888 2010 Defining the membrane proteome of NK cells.
18281296 2008 Contribution of peroxisome-specific isoform of Lon protease in sorting PTS1 proteins to peroxisomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...