Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.20
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.200 6.6e-03
atypical teratoid / rhabdoid tumor -1.500 7.9e-05
colon cancer -1.700 4.8e-02
cutaneous lupus erythematosus -1.200 5.9e-03
ependymoma -1.100 2.9e-02
glioblastoma -1.200 5.7e-03
group 3 medulloblastoma -1.300 5.5e-03
intraductal papillary-mucinous adenoma (... 1.200 7.4e-03
invasive ductal carcinoma -1.100 9.8e-03
lung cancer -2.400 1.7e-03
malignant mesothelioma -1.300 1.1e-05
medulloblastoma, large-cell -1.300 7.0e-03
non-small cell lung cancer -1.281 6.6e-14
oligodendroglioma 1.300 1.2e-02
osteosarcoma -2.164 1.3e-04
ovarian cancer -2.000 1.3e-06
pancreatic ductal adenocarcinoma liver m... -3.060 2.6e-03
primitive neuroectodermal tumor -1.300 3.5e-03
psoriasis -1.500 2.0e-05

Gene RIF (2)

AA Sequence

MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVIPNTPDPASDA      1 - 70
QDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMR     71 - 140
EELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPREALPDILTSIIRTSNKEKLQILDAVSLEER    141 - 210
FKMTIPLLVRQIEGLKLLQKTRKPKQDDDKRVIAIRPIRRITHISGTLEDEDEDEDNDDIVMLEKKIRTS    211 - 280
SMPEQAHKVCVKEIKRLKKMPQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLK    281 - 350
KRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGS    351 - 420
MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDLSQVLFIAT    421 - 490
ANTTATIPAALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGLTPQQIQIPQVTTLDIITRYTREAG    491 - 560
VRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGCREHILEDEKPESISDTTDLALPPEMPILID    561 - 630
FHALKDILGPPMYEMEVSQRLSQPGVAIGLAWTPLGGEIMFVEASRMDGEGQLTLTGQLGDVMKESAHLA    631 - 700
ISWLRSNAKKYQLTNAFGSFDLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGE    701 - 770
ITLRGLVLPVGGIKDKVLAAHRAGLKQVIIPRRNEKDLEGIPGNVRQDLSFVTASCLDEVLNAAFDGGFT    771 - 840
VKTRPGLLNSKL                                                              841 - 852
//

Text Mined References (13)

PMID Year Title