Property Summary

NCBI Gene PubMed Count 16
PubMed Score 18.39
PubTator Score 18.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 9.22784367449254E-19
group 3 medulloblastoma 2254 2.78760017522281E-6
malignant mesothelioma 3163 3.66240969416252E-6
lung cancer 4473 3.86797076843637E-4
diabetes mellitus 1663 0.00177886377863623

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
group 3 medulloblastoma 1.900 0.000
lung cancer 1.400 0.000
diabetes mellitus 1.300 0.002
lung carcinoma 1.100 0.000

Synonym

Accession Q86WA6 Q00306 Q13855 Q3KP51 VACVase
Symbols MCNAA
BPH-RP
VACVASE

Gene

PANTHER Protein Class (3)

PDB

2OCG   2OCI   2OCK   2OCL  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25333274 The catalytic efficiency (kcat/Km) of rBPHL for homocysteine thiolactone hydrolysis was 7.7 x 10(4) M(-1)s(-1), orders of magnitude higher than that of PON1 or Blmh, indicating a more significant physiological role for BPHL in detoxifying HCTL
20877624 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
15832508 BPHL catalyzes the hydrolytic activation of the antiviral prodrugs valacyclovir and valganciclovir.
12732646 BPHL is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nuceloside analogs such as valacyclovir and valganciclovir.

AA Sequence

MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGML      1 - 70
GSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSD     71 - 140
GGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWV    141 - 210
DGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFAD    211 - 280
EFNKLAEDFLQ                                                               281 - 291
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25333274 2014 Human valacyclovir hydrolase/biphenyl hydrolase-like protein is a highly efficient homocysteine thiolactonase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18256025 2008 Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
18163890 2008 HNF4 alpha orchestrates a set of 14 genes to down-regulate cell proliferation in kidney cells.
16316342 2005 Transcriptional analysis of the molecular basis of human kidney aging using cDNA microarray profiling.
More...