Property Summary

NCBI Gene PubMed Count 16
Grant Count 18
R01 Count 13
Funding $8,086,841.5
PubMed Score 18.39
PubTator Score 18.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
group 3 medulloblastoma 1.900 0.000
lung cancer 1.400 0.000
diabetes mellitus 1.300 0.002
lung carcinoma 1.100 0.000

Gene RIF (5)

PMID Text
25333274 The catalytic efficiency (kcat/Km) of rBPHL for homocysteine thiolactone hydrolysis was 7.7 x 10(4) M(-1)s(-1), orders of magnitude higher than that of PON1 or Blmh, indicating a more significant physiological role for BPHL in detoxifying HCTL
20877624 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
15832508 BPHL catalyzes the hydrolytic activation of the antiviral prodrugs valacyclovir and valganciclovir.
12732646 BPHL is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nuceloside analogs such as valacyclovir and valganciclovir.

AA Sequence

MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGML      1 - 70
GSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSD     71 - 140
GGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWV    141 - 210
DGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFAD    211 - 280
EFNKLAEDFLQ                                                               281 - 291
//

Publication (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25333274 2014 Human valacyclovir hydrolase/biphenyl hydrolase-like protein is a highly efficient homocysteine thiolactonase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18256025 2008 Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
18163890 2008 HNF4 alpha orchestrates a set of 14 genes to down-regulate cell proliferation in kidney cells.
16316342 2005 Transcriptional analysis of the molecular basis of human kidney aging using cDNA microarray profiling.
More...