Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.09
PubTator Score 18.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 9.2e-19
group 3 medulloblastoma 4104 2.8e-06
malignant mesothelioma 3232 3.7e-06
lung cancer 4740 3.9e-04
diabetes mellitus 1728 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus 1.300 1.8e-03
group 3 medulloblastoma 1.900 2.8e-06
lung cancer 1.400 3.9e-04
lung carcinoma 1.100 9.2e-19
malignant mesothelioma -1.100 3.7e-06

Gene RIF (5)

AA Sequence

MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGML      1 - 70
GSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSD     71 - 140
GGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWV    141 - 210
DGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFAD    211 - 280
EFNKLAEDFLQ                                                               281 - 291
//

Text Mined References (20)

PMID Year Title