Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
R01 Count 7
Funding $342,430.17
PubMed Score 3.47
PubTator Score 6.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (6)

PMID Text
21855798 Liprins can mediate assembly of target proteins into large protein complexes capable of regulating numerous cellular activities.
21430068 Novel ALK fusions are being identified in various tumors in addition to inflammatory myofibroblastic tumor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein, binding protein 1, beta 1 (PPFIBP1) is important for HIV-1 replication
19965622 liprin beta1, a member of the family of LAR transmembrane tyrosine phosphatase-interacting proteins, as highly expressed in intestinal lymphatic endothelial cells in vitro and lymphatic vasculature in vivo
11836260 new molecular target of the S100A4 protein, liprin beta1

AA Sequence

MMSDASDMLAAALEQMDGIIAGSKALEYSNGIFDCQSPTSPFMGSLRALHLVEDLRGLLEMMETDEKEGL      1 - 70
RCQIPDSTAETLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQGEKIRDLEFC     71 - 140
LEEHREKVNATEEMLQQELLSRTSLETQKLDLMAEISNLKLKLTAVEKDRLDYEDKFRDTEGLIQEINDL    141 - 210
RLKVSEMDSERLQYEKKLKSTKSLMAKLSSMKIKVGQMQYEKQRMEQKWESLKDELASLKEQLEEKESEV    211 - 280
KRLQEKLVCKMKGEGVEIVDRDIEVQKMKKAVESLMAANEEKDRKIEDLRQCLNRYKKMQDTVVLAQGKD    281 - 350
GEYEELLNSSSISSLLDAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSME    351 - 420
TSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA    421 - 490
PAESRPFGTLPPRPPGQDTSMDDNPFGTRKVRSSFGRGFFKIKSNKRTASAPNLAETEKETAEHLDLAGA    491 - 560
SSRPKDSQRNSPFQIPPPSPDSKKKSRGIMKLFGKLRRSQSTTFNPDDMSEPEFKRGGTRATAGPRLGWS    561 - 630
RDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKK    631 - 700
LQLALQALGSEEETNHGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHL    701 - 770
SIKRAIQVLRINNFEPNCLRRRPSDENTIAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVL    771 - 840
EPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVKPKKLAFSNF    841 - 910
GNLRKKKQEDGEEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLEQMEDSEGTVRQIGAFSEGIN    911 - 980
NLTHMLKEDDMFKDFAARSPSASITDEDSNV                                           981 - 1011
//

Text Mined References (26)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21855798 2011 Liprin-mediated large signaling complex organization revealed by the liprin-?/CASK and liprin-?/liprin-? complex structures.
21430068 2011 Pulmonary inflammatory myofibroblastic tumor expressing a novel fusion, PPFIBP1-ALK: reappraisal of anti-ALK immunohistochemistry as a tool for novel ALK fusion identification.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...