Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.53
PubTator Score 6.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia 1.900 2.3e-02
aldosterone-producing adenoma -1.251 1.5e-02
astrocytic glioma -1.900 7.5e-03
glioblastoma -1.300 3.6e-03
group 3 medulloblastoma -1.400 3.4e-02
intraductal papillary-mucinous adenoma (... 1.800 9.5e-04
intraductal papillary-mucinous carcinoma... 1.200 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.5e-02
lung adenocarcinoma -1.100 5.4e-13
lung carcinoma -1.100 3.9e-10
malignant mesothelioma -1.200 6.5e-04
medulloblastoma, large-cell -1.400 9.4e-03
osteosarcoma 1.655 7.9e-03
ovarian cancer -1.800 1.0e-03
Pick disease 2.000 1.0e-06
pituitary cancer -1.100 1.7e-02
posterior fossa group B ependymoma -1.100 5.0e-04
psoriasis -2.500 8.6e-05
spina bifida -1.124 2.9e-02

Gene RIF (8)

AA Sequence

MMSDASDMLAAALEQMDGIIAGSKALEYSNGIFDCQSPTSPFMGSLRALHLVEDLRGLLEMMETDEKEGL      1 - 70
RCQIPDSTAETLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQGEKIRDLEFC     71 - 140
LEEHREKVNATEEMLQQELLSRTSLETQKLDLMAEISNLKLKLTAVEKDRLDYEDKFRDTEGLIQEINDL    141 - 210
RLKVSEMDSERLQYEKKLKSTKSLMAKLSSMKIKVGQMQYEKQRMEQKWESLKDELASLKEQLEEKESEV    211 - 280
KRLQEKLVCKMKGEGVEIVDRDIEVQKMKKAVESLMAANEEKDRKIEDLRQCLNRYKKMQDTVVLAQGKD    281 - 350
GEYEELLNSSSISSLLDAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSME    351 - 420
TSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA    421 - 490
PAESRPFGTLPPRPPGQDTSMDDNPFGTRKVRSSFGRGFFKIKSNKRTASAPNLAETEKETAEHLDLAGA    491 - 560
SSRPKDSQRNSPFQIPPPSPDSKKKSRGIMKLFGKLRRSQSTTFNPDDMSEPEFKRGGTRATAGPRLGWS    561 - 630
RDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKK    631 - 700
LQLALQALGSEEETNHGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHL    701 - 770
SIKRAIQVLRINNFEPNCLRRRPSDENTIAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVL    771 - 840
EPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVKPKKLAFSNF    841 - 910
GNLRKKKQEDGEEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLEQMEDSEGTVRQIGAFSEGIN    911 - 980
NLTHMLKEDDMFKDFAARSPSASITDEDSNV                                           981 - 1011
//

Text Mined References (29)

PMID Year Title