Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.47
PubTator Score 2.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.36477952328659E-14
hepatocellular carcinoma 550 1.37009729072164E-5
tuberculosis and treatment for 6 months 686 2.28698181896383E-5
pediatric high grade glioma 2712 2.02448775232337E-4
atypical teratoid / rhabdoid tumor 4369 3.97882831278067E-4
ovarian cancer 8492 0.00207757295536662
gastric cancer 436 0.00480670379485491
glioblastoma 5572 0.00686121484535759
osteosarcoma 7933 0.0069127785081759
astrocytoma 1493 0.00915912120236905
pancreatic cancer 2300 0.0205410341006772
pancreatic carcinoma 567 0.0205410341006772
Disease Target Count Z-score Confidence
Cowpox 15 4.81 2.4
Scrub typhus 7 4.249 2.1
Q fever 11 3.147 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.200 0.005
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.100 0.021
osteosarcoma 1.625 0.007
glioblastoma -1.900 0.007
astrocytoma -1.100 0.009
atypical teratoid / rhabdoid tumor -1.500 0.000
tuberculosis and treatment for 6 months -1.800 0.000
pediatric high grade glioma -1.400 0.000
pancreatic carcinoma 1.100 0.021
lung carcinoma 1.100 0.000
ovarian cancer -1.200 0.002

Synonym

Accession Q86W74 Q6P9B7
Symbols ANK-S
GENX-115279

Gene

  Ortholog (11)

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGAD      1 - 70
LLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFN     71 - 140
RGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSLGIA    141 - 210
YYRRTLRLGSFARQDRSRIQAI                                                    211 - 232
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22559327 2012 Identification of genes with a correlation between copy number and expression in gastric cancer.
21269460 2011 Initial characterization of the human central proteome.
21219636 2011 Knockdown of miR-21 in human breast cancer cell lines inhibits proliferation, in vitro migration and in vivo tumor growth.
21041692 2010 Identification of genomic predictors of atrioventricular conduction: using electronic medical records as a tool for genome science.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17176038 2006 Ankyrin repeat: a unique motif mediating protein-protein interactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15152081 2004 The ankyrin repeat as molecular architecture for protein recognition.
More...