Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
Funding $420,070.05
PubMed Score 17.47
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.200 0.005
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.100 0.021
osteosarcoma 1.625 0.007
glioblastoma -1.900 0.007
astrocytoma -1.100 0.009
atypical teratoid / rhabdoid tumor -1.500 0.000
tuberculosis and treatment for 6 months -1.800 0.000
pediatric high grade glioma -1.400 0.000
pancreatic carcinoma 1.100 0.021
lung carcinoma 1.100 0.000
ovarian cancer -1.200 0.002

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGAD      1 - 70
LLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFN     71 - 140
RGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSLGIA    141 - 210
YYRRTLRLGSFARQDRSRIQAI                                                    211 - 232
//

Publication (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22559327 2012 Identification of genes with a correlation between copy number and expression in gastric cancer.
21269460 2011 Initial characterization of the human central proteome.
21219636 2011 Knockdown of miR-21 in human breast cancer cell lines inhibits proliferation, in vitro migration and in vivo tumor growth.
21041692 2010 Identification of genomic predictors of atrioventricular conduction: using electronic medical records as a tool for genome science.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17176038 2006 Ankyrin repeat: a unique motif mediating protein-protein interactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15152081 2004 The ankyrin repeat as molecular architecture for protein recognition.
More...