Property Summary

NCBI Gene PubMed Count 12
PubMed Score 16.81
PubTator Score 2.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 4.5e-04
astrocytoma -1.100 9.2e-03
atypical teratoid / rhabdoid tumor -1.500 4.0e-04
gastric cancer 1.200 4.8e-03
glioblastoma -1.200 1.9e-05
hepatocellular carcinoma 1.500 1.4e-05
lung carcinoma 1.100 2.4e-14
osteosarcoma 1.625 6.9e-03
ovarian cancer -1.200 2.1e-03
pancreatic cancer 1.100 2.1e-02
pancreatic carcinoma 1.100 2.1e-02
tuberculosis -1.500 2.5e-04

Synonym

Accession Q86W74 Q6P9B7
Symbols ANK-S
GENX-115279

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGAD      1 - 70
LLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFN     71 - 140
RGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSLGIA    141 - 210
YYRRTLRLGSFARQDRSRIQAI                                                    211 - 232
//

Text Mined References (15)

PMID Year Title