Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.300 1.6e-03
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
glioblastoma 1.500 1.2e-03
medulloblastoma 1.100 1.4e-02
medulloblastoma, large-cell 1.800 4.8e-06
osteosarcoma 3.608 4.0e-12
ovarian cancer 1.400 1.4e-12
posterior fossa group B ependymoma 1.500 2.5e-06
psoriasis 1.100 5.5e-61

Gene RIF (1)

AA Sequence

MATPLGWSKAGSGSVCLALDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKT      1 - 70
KVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLITKCNEIESHIIKQEDI     71 - 140
LNGKENEIKELQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQHPREK         141 - 205
//

Text Mined References (10)

PMID Year Title