Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 3.608 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.001
medulloblastoma 1.100 0.014
medulloblastoma, large-cell 1.800 0.000
adult high grade glioma 1.300 0.002
posterior fossa group B ependymoma 1.500 0.000
ovarian cancer 1.400 0.000
psoriasis 1.100 0.000

Synonym

Accession Q86W54
Symbols T6441
CCDC161

Gene

Gene RIF (1)

PMID Text
19240791 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATPLGWSKAGSGSVCLALDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKT      1 - 70
KVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLITKCNEIESHIIKQEDI     71 - 140
LNGKENEIKELQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQHPREK         141 - 205
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19515240 2009 TIPT2 and geminin interact with basal transcription factors to synergize in transcriptional regulation.
19240791 2009 Integrated genomic analysis implicates haploinsufficiency of multiple chromosome 5q31.2 genes in de novo myelodysplastic syndromes pathogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16146721 2006 Cloning and characterization of a novel spermiogenesis-related gene, T6441, in rat testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.