Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.80
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.9e-06
ependymoma 1.100 2.3e-07
group 3 medulloblastoma 1.200 4.5e-03
medulloblastoma, large-cell 1.400 4.4e-05
osteosarcoma 1.103 6.4e-03
ovarian cancer -1.300 9.0e-05
primitive neuroectodermal tumor 1.200 1.8e-03
psoriasis -1.100 7.6e-04

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDI      1 - 70
PLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFN     71 - 140
YAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSV    141 - 210
NTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRT    211 - 280
MRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSLKASPLRSETAEGIVVVTTWIEKIL    281 - 350
TDLKVQHKRVPCGKEEVSLFLTAIENSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQ    351 - 420
ELARGPQERTPCGPALREGEAAAVEGPCPSQESLSQEENPEPTEDERSEEKGGVEVLESCQGSSNGAQDQ    421 - 490
EASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVEGQNRDLMNQLCTYIRNQIFRLVA    491 - 560
VN                                                                        561 - 562
//

Text Mined References (18)

PMID Year Title