Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.23
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 2.32787177488704E-7
atypical teratoid / rhabdoid tumor 4369 7.89946108033756E-6
medulloblastoma, large-cell 6234 4.42263052281403E-5
ovarian cancer 8492 8.96301371531202E-5
medulloblastoma 1524 3.9262455900535E-4
psoriasis 6685 7.64486356712096E-4
primitive neuroectodermal tumor 3031 0.00180136711201492
osteosarcoma 7933 0.00640538740764374

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma 1.103 0.006
ependymoma 1.100 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.200 0.002
ovarian cancer -1.300 0.000

Synonym

Accession Q86W50 D3DTI8 Q86TE5 Q96T16 Q9BVG7
Symbols METT10D

Gene

PANTHER Protein Class (2)

PDB

2H00  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
20602751 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDI      1 - 70
PLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFN     71 - 140
YAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSV    141 - 210
NTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRT    211 - 280
MRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSLKASPLRSETAEGIVVVTTWIEKIL    281 - 350
TDLKVQHKRVPCGKEEVSLFLTAIENSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQ    351 - 420
ELARGPQERTPCGPALREGEAAAVEGPCPSQESLSQEENPEPTEDERSEEKGGVEVLESCQGSSNGAQDQ    421 - 490
EASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVEGQNRDLMNQLCTYIRNQIFRLVA    491 - 560
VN                                                                        561 - 562
//

Text Mined References (15)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18021804 2008 The ybiN gene of Escherichia coli encodes adenine-N6 methyltransferase specific for modification of A1618 of 23 S ribosomal RNA, a methylated residue located close to the ribosomal exit tunnel.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...