Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.50
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Multiple myeloma 1332 3.4e-04
ovarian cancer 8520 1.1e-03
lung cancer 4740 2.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 2.2e-02
Multiple myeloma 1.774 3.4e-04
ovarian cancer -1.400 1.1e-03

Gene RIF (2)

AA Sequence

MQIIRHSEQTLKTALISKNPVLVSQYEKLNAGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDF      1 - 70
EQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIISEEYIKWLTGYCKAYFYGLRVKLLEPVPVSVTRCSFR     71 - 140
VNENTHNLQIHAGDILKFLKKKKPEDAFCVVGITMIDLYPRDSWNFVFGQASLTDGVGIFSFARYGSDFY    141 - 210
SMHYKGKVKKLKKTSSSDYSIFDNYYIPEITSVLLLRSCKTLTHEIGHIFGLRHCQWLACLMQGSNHLEE    211 - 280
ADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDESSDTPGATPEHSHEDNGNLPKPVEAFKEWKEW    281 - 350
IIKCLAVLQK                                                                351 - 360
//

Text Mined References (11)

PMID Year Title