Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.50
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.774 0.000
lung cancer 1.300 0.022
ovarian cancer 1.500 0.007

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15972818 human archaemetzincin-1 and -2 are two novel members of a family of metalloproteases widely distributed in Archaea

AA Sequence

MQIIRHSEQTLKTALISKNPVLVSQYEKLNAGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDF      1 - 70
EQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIISEEYIKWLTGYCKAYFYGLRVKLLEPVPVSVTRCSFR     71 - 140
VNENTHNLQIHAGDILKFLKKKKPEDAFCVVGITMIDLYPRDSWNFVFGQASLTDGVGIFSFARYGSDFY    141 - 210
SMHYKGKVKKLKKTSSSDYSIFDNYYIPEITSVLLLRSCKTLTHEIGHIFGLRHCQWLACLMQGSNHLEE    211 - 280
ADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDESSDTPGATPEHSHEDNGNLPKPVEAFKEWKEW    281 - 350
IIKCLAVLQK                                                                351 - 360
//

Text Mined References (11)

PMID Year Title
27602123 2016 Refined-mapping of the novel TSG within the 17q24.3 chromosomal region in non-small cell lung cancer samples.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17074343 2006 Identification of ten novel genes involved in human spermatogenesis by microarray analysis of testicular tissue.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15972818 2005 Identification and characterization of human archaemetzincin-1 and -2, two novel members of a family of metalloproteases widely distributed in Archaea.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...