Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.22
PubTator Score 2.31

Knowledge Summary

Patent (1,700)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.400 0.000
tuberculosis and treatment for 3 months -1.800 0.000

Gene RIF (1)

PMID Text
26451044 Gpr175 is a novel positive regulator of the Hh signaling pathway

AA Sequence

MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSRVRYWDLLLLIPNVLFLIFLLWKLPSARA      1 - 70
KIRITSSPIFITFYILVFVVALVGIARAVVSMTVSTSNAATVADKILWEITRFFLLAIELSVIILGLAFG     71 - 140
HLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDAHLSAEDFNIYGHGGRQFWLVSSCFFFLVYSLVVI    141 - 210
LPKTPLKERISLPSRRSFYVYAGILALLNLLQGLGSVLLCFDIIEGLCCVDATTFLYFSFFAPLIYVAFL    211 - 280
RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDI    281 - 350
ASMPCHTGSINSTDSERWKAINA                                                   351 - 373
//

Text Mined References (10)

PMID Year Title
26451044 2015 The Orphan G Protein-coupled Receptor Gpr175 (Tpra40) Enhances Hedgehog Signaling by Modulating cAMP Levels.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10342878 1999 Differential expression of a novel seven transmembrane domain protein in epididymal fat from aged and diabetic mice.
9776767 1998 A method for global protein expression and antibody screening on high-density filters of an arrayed cDNA library.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.