Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.22
PubTator Score 2.31

Knowledge Summary

Patent (1,700)

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 4.9e-07
psoriasis 6694 5.9e-05
Disease Target Count Z-score Confidence
Raynaud disease 6 4.53 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.400 5.9e-05
tuberculosis -1.700 4.9e-07

Gene RIF (1)

AA Sequence

MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSRVRYWDLLLLIPNVLFLIFLLWKLPSARA      1 - 70
KIRITSSPIFITFYILVFVVALVGIARAVVSMTVSTSNAATVADKILWEITRFFLLAIELSVIILGLAFG     71 - 140
HLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDAHLSAEDFNIYGHGGRQFWLVSSCFFFLVYSLVVI    141 - 210
LPKTPLKERISLPSRRSFYVYAGILALLNLLQGLGSVLLCFDIIEGLCCVDATTFLYFSFFAPLIYVAFL    211 - 280
RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDI    281 - 350
ASMPCHTGSINSTDSERWKAINA                                                   351 - 373
//

Text Mined References (10)

PMID Year Title