Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.57
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Carcinoma 2,147 1.0
osteosarcoma 7,933

Gene RIF (3)

PMID Text
20403135 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDVNPPSDTPIPFSSSSTHSSHIPPWTFSCYPGSPCENGVMLYMRNVSHEELQRFKQLLLTELSTGTMP      1 - 70
ITWDQVETASWAEVVHLLIERFPGRRAWDVTSNIFAIMNCDKMCVVVRREINAILPTLEPEDLNVGETQV     71 - 140
NLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVAIQG    141 - 210
APGIGKTILAKKVMFEWARNKFYAHKRWCAFYFHCQEVNQTTDQSFSELIEQKWPGSQDLVSKIMSKPDQ    211 - 280
LLLLLDGFEELTSTLIDRLEDLSEDWRQKLPGSVLLSSLLSKTMLPEATLLIMIRFTSWQTCKPLLKCPS    281 - 350
LVTLPGFNTMEKIKYFQMYFGHTEEGDQVLSFAMENTILFSMCRVPVVCWMVCSGLKQQMERGNNLTQSC    351 - 420
PNATSVFVRYISSLFPTRAENFSRKIHQAQLEGLCHLAADSMWHRKWVLGKEDLEEAKLDQTGVTAFLGM    421 - 490
SILRRIAGEEDHYVFTLVTFQEFFAALFYVLCFPQRLKNFHVLSHVNIQRLIASPRGSKSYLSHMGLFLF    491 - 560
GFLNEACASAVEQSFQCKVSFGNKRKLLKVIPLLHKCDPPSPGSGVPQLFYCLHEIREEAFVSQALNDYH    561 - 630
KVVLRIGNNKEVQVSAFCLKRCQYLHEVELTVTLNFMNVWKLSSSSHPGSEAPESNGLHRWWQDLCSVFA    631 - 700
TNDKLEVLTMTNSVLGPPFLKALAAALRHPQCKLQKLLLRRVNSTMLNQDLIGVLTGNQHLRYLEIQHVE    701 - 770
VESKAVKLLCRVLRSPRCRLQCLRLEDCLATPRIWTDLGNNLQGNGHLKTLILRKNSLENCGAYYLSVAQ    771 - 840
LERLSIENCNLTQLTCESLASCLRQSKMLTHLSLAENALKDEGAKHIWNALPHLRCPLQRLVLRKCDLTF    841 - 910
NCCQDMISALCKNKTLKSLDLSFNSLKDDGVILLCEALKNPDCTLQILELENCLFTSICCQAMASMLRKN    911 - 980
QHLRHLDLSKNAIGVYGILTLCEAFSSQKKREEVIFCIPAWTRITSFSPTPHPPDFTGKSDCLSQINP      981 - 1048
//

Text Mined References (10)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22166940 2012 A genome-wide study reveals rare CNVs exclusive to extreme phenotypes of Alzheimer disease.
20403135 2010 The genetics of NOD-like receptors in Crohn's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18648497 2008 Expression analysis of the NLRP gene family suggests a role in human preimplantation development.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
12766759 2003 NODs: intracellular proteins involved in inflammation and apoptosis.
12563287 2003 NALPs: a novel protein family involved in inflammation.