Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.87
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 2.3e-15
lung adenocarcinoma 2716 1.7e-14
breast carcinoma 1638 5.8e-05
fibroadenoma 559 1.0e-03
osteosarcoma 7950 2.7e-03
invasive ductal carcinoma 2951 1.3e-02
ductal carcinoma in situ 1745 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.400 5.8e-05
ductal carcinoma in situ 3.300 4.5e-02
fibroadenoma 2.200 1.0e-03
invasive ductal carcinoma 3.900 1.3e-02
lung adenocarcinoma -1.100 1.7e-14
lung carcinoma -1.800 2.3e-15
osteosarcoma -1.238 2.7e-03

Gene RIF (10)

AA Sequence

MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHKEFYPVKEFEVYH      1 - 70
KLMEKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESWVGRGLVTLDGSKWKKHRQIV     71 - 140
KPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAFSHQGSIQLDSTLDS    141 - 210
YLKAVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKR    211 - 280
RWDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGD    281 - 350
GSSITWEHLSQMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWED    351 - 420
PQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVRQVV    421 - 490
LKSKNGIHVFAKKVC                                                           491 - 505
//

Text Mined References (15)

PMID Year Title