Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.27
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.238 0.003
fibroadenoma 2.200 0.001
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.800 0.000
breast carcinoma 1.400 0.000
ductal carcinoma in situ 3.300 0.045
invasive ductal carcinoma 3.900 0.013

Synonym

Accession Q86W10 Q5VVE4
Symbols CYP4A20

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
25701119 Our findings suggest that the CYP4Z2P- and CYP4Z1-3'UTR promote breast cancer angiogenesis collectively by activating the PI3K and ERK1/2 pathways through binding multiple miRNAs.
22841774 CYP4Z1 overexpression promotes tumor angiogenesis and growth in breast cancer partly via PI3K/Akt and ERK1/2 activation
19473719 CYP4Z1, KIR and RDH10 could play a role in non-small-cell lung cancer progression
19090726 CYP4Z1-dependent in-chain hydroxylation of lauric and myristic acid, which in both cases leads to the formation of four different monohydroxylated products at positions omega-2, omega-3, omega-4, and omega-5, respectively
15797250 PPARalpha has a role in CYP4X1 regulation, and the glucocorticoid and progesterone receptors have roles in CYP4Z1 gene activation
15059886 Human cytochrome P450 (CYP), termed CYP4Z1,was identified, and the cDNA was cloned from a breast carcinoma line .

AA Sequence

MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHKEFYPVKEFEVYH      1 - 70
KLMEKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESWVGRGLVTLDGSKWKKHRQIV     71 - 140
KPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAFSHQGSIQLDSTLDS    141 - 210
YLKAVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKR    211 - 280
RWDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGD    281 - 350
GSSITWEHLSQMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWED    351 - 420
PQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVRQVV    421 - 490
LKSKNGIHVFAKKVC                                                           491 - 505
//

Text Mined References (11)

PMID Year Title
25701119 2015 The 3'UTR of the pseudogene CYP4Z2P promotes tumor angiogenesis in breast cancer by acting as a ceRNA for CYP4Z1.
22841774 2012 Increased expression of CYP4Z1 promotes tumor angiogenesis and growth in human breast cancer.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
19090726 2009 Human CYP4Z1 catalyzes the in-chain hydroxylation of lauric acid and myristic acid.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15797250 2005 Conditional regulation of the human CYP4X1 and CYP4Z1 genes.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15059886 2004 Identification of a novel mammary-restricted cytochrome P450, CYP4Z1, with overexpression in breast carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...