Property Summary

NCBI Gene PubMed Count 86
PubMed Score 42.80
PubTator Score 43.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count
Endometrial stromal sarcoma 15

Expression

  Differential Expression (22)

Gene RIF (74)

AA Sequence

MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAAR      1 - 70
REQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYE     71 - 140
ESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKC    141 - 210
RCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ                                         211 - 243
//

Text Mined References (88)

PMID Year Title