Property Summary

NCBI Gene PubMed Count 85
Grant Count 19
R01 Count 13
Funding $2,362,255.01
PubMed Score 39.61
PubTator Score 43.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (73)

PMID Text
25785549 study found SNP rs7754840 in CDKAL1, rs864745 in JAZF1, and rs35767 in IGF1 might serve as potential susceptibility loci for type 2 diabetes in the Uyghur population
25596907 genetic association study in Han population in China: Data suggest an SNP in PXK [rs2176082(C/T); but not rs6445975(G/T)] is associated with recurrent pregnancy loss; SNPs in KIAA0319L [rs2275247(A/G)] or JAZF1 [rs1635852(C/T)] are not associated.
24801046 In African American men, the association between JAZF1 rs10486567 and prostate cancer may be modified by exposure to heavy metals such as Pb.
23740937 study determined that the previously described systemic lupus erythematosus susceptibility loci PXK (P = 3.27 x 10(-11), OR = 1.20) and JAZF1 (P = 1.11 x 10(-8), OR = 1.13) are shared with systemic sclerosis
23328127 genetic association studies in a population in Utah: Data suggest that an SNP in JAZF1 (rs1635852) is associated with type 2 diabetes; this SNP in JAZF1 intron 1 is part of a cis-regulatory complex.
22918161 Morphological features, immunoprofile and fluorescence in situ hybridization rearrangements of JAZF1 and PHF1 genes were correlated with tumor category and outcome in endometrial sarcomas
22113416 This study indicates a nominal role for JAZF1 and BCL11A variants in type 2 diabetes susceptibility in African-Americans.
21071540 Observational study of gene-disease association. (HuGE Navigator)
21068098 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAAR      1 - 70
REQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYE     71 - 140
ESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKC    141 - 210
RCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ                                         211 - 243
//

Publication (87)

PMID Year Title
25785549 2015 The Uyghur population and genetic susceptibility to type 2 diabetes: potential role for variants in CDKAL1, JAZF1, and IGF1 genes.
25596907 2015 Association between KIAA0319L, PXK and JAZF1 gene polymorphisms and unexplained recurrent pregnancy loss in Chinese Han couples.
24801046 2014 Gene-environment interactions between JAZF1 and occupational and household lead exposure in prostate cancer among African American men.
24722205 2014 A genome-wide association study on thyroid function and anti-thyroid peroxidase antibodies in Koreans.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23328127 2013 Allele-specific transcriptional activity at type 2 diabetes-associated single nucleotide polymorphisms in regions of pancreatic islet open chromatin at the JAZF1 locus.
More...