Property Summary

NCBI Gene PubMed Count 5
PubMed Score 30.81
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 5.64575774536941E-29
ovarian cancer 8492 7.44837424162242E-9
cystic fibrosis 1670 1.98616229275392E-7
primary pancreatic ductal adenocarcinoma 1271 9.15832450065916E-5
pancreatic cancer 2300 4.61327477044696E-4
primary Sjogren syndrome 789 0.00269072105314399
Breast cancer 3099 0.00272404563644434
nasopharyngeal carcinoma 1056 0.00479229759805655
pilocytic astrocytoma 3086 0.00977986560770943
head and neck cancer 270 0.0121519713475485
oligodendroglioma 2849 0.0172743681988555
atypical teratoid / rhabdoid tumor 4369 0.0200763241861483
active Crohn's disease 918 0.0281305910306038
astrocytic glioma 2241 0.0307712150665012
medulloblastoma, large-cell 6234 0.033272516149738
active ulcerative colitis 477 0.0337148437549489
Endometriosis 535 0.0495046576443644

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.100 0.031
oligodendroglioma -2.400 0.017
glioblastoma multiforme -1.900 0.000
cystic fibrosis 5.419 0.000
atypical teratoid / rhabdoid tumor -1.500 0.020
medulloblastoma, large-cell -2.500 0.033
primary pancreatic ductal adenocarcinoma 2.708 0.000
active Crohn's disease 3.122 0.028
active ulcerative colitis 3.328 0.034
pancreatic cancer 2.300 0.000
pilocytic astrocytoma -2.000 0.010
primary Sjogren syndrome 1.200 0.003
nasopharyngeal carcinoma 1.600 0.005
Endometriosis 1.269 0.050
Breast cancer -1.100 0.003
ovarian cancer -3.500 0.000
head and neck cancer -1.400 0.012

Synonym

Accession Q86VY9 Q96PX5
Symbols TTMA
TTMC
KIAA1913

Gene

  Ortholog (14)

AA Sequence

MIATGGVITGLAALKRQDSARSQQHVNLSPSPATQEKKPIRRRPRADVVVVRGKIRLYSPSGFFLILGVL      1 - 70
ISIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIF     71 - 140
ICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQRQMNGMYTGLMGETEVKQNGSSCASRLAANTI    141 - 210
ASFSGFRSSFRMDSSVEEDELMLNEGKSSGHLMPPLLSDSSVSVFGLYPPPSKTTDDKTSGSKKCETKSI    211 - 280
VSSSISAFTLPVIKLNNCVIDEPSIDNITEDADNLKSRSRNLSMDSLVVPLPNTSESFQPVSTVLPRNNS    281 - 350
IGESLSSQYKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWP    351 - 420
RLDRNNSKGYMKLENKEDPMDRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETR    421 - 490
F//

Text Mined References (9)

PMID Year Title
25192705 2014 No evidence of gene-calcium interactions from genome-wide analysis of colorectal cancer risk.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16000565 2005 Identification of a novel homozygous deletion region at 6q23.1 in medulloblastomas using high-resolution array comparative genomic hybridization analysis.
15722956 2005 Candidate psychiatric illness genes identified in patients with pericentric inversions of chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.