Property Summary

NCBI Gene PubMed Count 5
PubMed Score 30.81
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.100 0.031
oligodendroglioma -2.400 0.017
glioblastoma multiforme -1.900 0.000
cystic fibrosis 5.419 0.000
atypical teratoid / rhabdoid tumor -1.500 0.020
medulloblastoma, large-cell -2.500 0.033
primary pancreatic ductal adenocarcinoma 2.708 0.000
active Crohn's disease 3.122 0.028
active ulcerative colitis 3.328 0.034
pancreatic cancer 2.300 0.000
pilocytic astrocytoma -2.000 0.010
primary Sjogren syndrome 1.200 0.003
nasopharyngeal carcinoma 1.600 0.005
Endometriosis 1.269 0.050
Breast cancer -1.100 0.003
ovarian cancer -3.500 0.000
head and neck cancer -1.400 0.012

AA Sequence

MIATGGVITGLAALKRQDSARSQQHVNLSPSPATQEKKPIRRRPRADVVVVRGKIRLYSPSGFFLILGVL      1 - 70
ISIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIF     71 - 140
ICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQRQMNGMYTGLMGETEVKQNGSSCASRLAANTI    141 - 210
ASFSGFRSSFRMDSSVEEDELMLNEGKSSGHLMPPLLSDSSVSVFGLYPPPSKTTDDKTSGSKKCETKSI    211 - 280
VSSSISAFTLPVIKLNNCVIDEPSIDNITEDADNLKSRSRNLSMDSLVVPLPNTSESFQPVSTVLPRNNS    281 - 350
IGESLSSQYKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWP    351 - 420
RLDRNNSKGYMKLENKEDPMDRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETR    421 - 490
F//

Text Mined References (9)

PMID Year Title
25192705 2014 No evidence of gene-calcium interactions from genome-wide analysis of colorectal cancer risk.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16000565 2005 Identification of a novel homozygous deletion region at 6q23.1 in medulloblastomas using high-resolution array comparative genomic hybridization analysis.
15722956 2005 Candidate psychiatric illness genes identified in patients with pericentric inversions of chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.