Property Summary

NCBI Gene PubMed Count 5
PubMed Score 31.30
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 3.122 2.8e-02
active ulcerative colitis 3.328 3.4e-02
astrocytic glioma -2.100 3.1e-02
Astrocytoma, Pilocytic -2.000 8.9e-03
atypical teratoid / rhabdoid tumor -1.500 2.0e-02
Breast cancer -1.100 2.7e-03
cystic fibrosis 5.419 2.0e-07
Endometriosis 1.269 5.0e-02
glioblastoma -1.500 1.3e-02
head and neck cancer -1.400 1.2e-02
medulloblastoma, large-cell -2.500 3.3e-02
nasopharyngeal carcinoma 1.600 4.8e-03
oligodendroglioma -2.400 1.7e-02
ovarian cancer -3.500 7.4e-09
pancreatic cancer 1.500 1.7e-03
primary pancreatic ductal adenocarcinoma 2.708 9.2e-05
primary Sjogren syndrome 1.200 2.7e-03

Synonym

Accession Q86VY9 Q96PX5
Symbols TTMA
TTMC
KIAA1913

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MIATGGVITGLAALKRQDSARSQQHVNLSPSPATQEKKPIRRRPRADVVVVRGKIRLYSPSGFFLILGVL      1 - 70
ISIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIF     71 - 140
ICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQRQMNGMYTGLMGETEVKQNGSSCASRLAANTI    141 - 210
ASFSGFRSSFRMDSSVEEDELMLNEGKSSGHLMPPLLSDSSVSVFGLYPPPSKTTDDKTSGSKKCETKSI    211 - 280
VSSSISAFTLPVIKLNNCVIDEPSIDNITEDADNLKSRSRNLSMDSLVVPLPNTSESFQPVSTVLPRNNS    281 - 350
IGESLSSQYKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWP    351 - 420
RLDRNNSKGYMKLENKEDPMDRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETR    421 - 490
F//

Text Mined References (9)

PMID Year Title