Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.82
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.0e-04
ovarian cancer 8520 2.4e-03
Disease Target Count Z-score Confidence
Acute chest syndrome 9 3.402 1.7
hepatocellular carcinoma 547 3.102 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.090 1.0e-04
ovarian cancer 1.100 2.4e-03

Gene RIF (7)

AA Sequence

MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRS      1 - 70
IVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQTLMINQLIDMEWK     71 - 140
FGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC              141 - 200
//

Text Mined References (21)

PMID Year Title