Property Summary

NCBI Gene PubMed Count 20
Grant Count 28
R01 Count 22
Funding $1,972,666.11
PubMed Score 30.45
PubTator Score 22.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.200 0.004
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma -1.600 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.500 0.001
pediatric high grade glioma -1.100 0.001

Gene RIF (14)

PMID Text
26435194 p63RhoGEF can rapidly activate RhoA through endogenous G-protein coupled receptors.
24356540 assessed p63RhoGEF gene and protein expression and RhoA/Rho kinase activity in essential hypertensive and Bartter's and Gitelman's syndrome patients, a model opposite to hypertension
23884432 Signaling efficiency of Galphaq through its effectors p63RhoGEF and GEFT depends on their subcellular location.
23380069 p63RhoGEF-mediated formation of a single polarized lamellipodium is required for chemotactic migration in breast carcinoma cells.
21885830 Signaling through p63RhoGEF provides a novel mechanism for selective regulation of blood pressure.
21832057 p63RhoGEF is regulated chiefly through allosteric control by Galpha(q), as opposed to other known Galpha-regulated RhoGEFs, which are instead sequestered in the cytoplasm, perhaps because of their high basal activity.
20739613 Specifically mediates angiotensin II- Gq/11-dependent RhoA activation and downstream signaling and processes in vascular smooth muscle cells
18851832 MLK3 functions in a regulated way to limit levels of the activated GTPase Rho by binding to the Rho activator, p63RhoGEF/GEFT, which, in turn, prevents its activation by Galphaq.
18096806 the crystal structure of the Galphaq-p63RhoGEF-RhoA complex, detailing the interactions of Galphaq with the Dbl and pleckstrin homology (DH and PH) domains of p63RhoGEF was determined
16496360 Together, our data provide new evidence suggesting that GEFT is an important regulator of multiple processes involved in axon and dendrite formation.
More...

AA Sequence

MRGGHKGGRCACPRVIRKVLAKCGCCFARGGRESYSIAGSEGSISASAASGLAAPSGPSSGLSSGPCSPG      1 - 70
PPGPVSGLRRWLDHSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEE     71 - 140
ETLSQAPESEEEQKKKALERSMYVLSELVETEKMYVDDLGQIVEGYMATMAAQGVPESLRGRDRIVFGNI    141 - 210
QQIYEWHRDYFLQELQRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHVVSEFGDSYFEELRQQLGH    211 - 280
RLQLNDLLIKPVQRIMKYQLLLKDFLKYYNRAGMDTADLEQAVEVMCFVPKRCNDMMTLGRLRGFEGKLT    281 - 350
AQGKLLGQDTFWVTEPEAGGLLSSRGRERRVFLFEQIIIFSEALGGGVRGGTQPGYVYKNSIKVSCLGLE    351 - 420
GNLQGDPCRFALTSRGPEGGIQRYVLQAADPAISQAWIKHVAQILESQRDFLNALQSPIEYQRRESQTNS    421 - 490
LGRPRGPGVGSPGRIQLGDQAQGSTHTPINGSLPSLLLSPKGEVARALLPLDKQALGDIPQAPHDSPPVS    491 - 560
PTPKTPPCQARLAKLDEDEL                                                      561 - 580
//

Publication (23)

PMID Year Title
26435194 2015 Plasma membrane restricted RhoGEF activity is sufficient for RhoA-mediated actin polymerization.
24356540 2014 Increased level of p63RhoGEF and RhoA/Rho kinase activity in hypertensive patients.
23884432 2013 Signaling efficiency of G?q through its effectors p63RhoGEF and GEFT depends on their subcellular location.
23380069 2013 p63RhoGEF-mediated formation of a single polarized lamellipodium is required for chemotactic migration in breast carcinoma cells.
22147804 2011 Does p63RhoGEF, a new key mediator of angiotensin II signalling, play a role in blood pressure regulation and cardiovascular remodelling in humans?
21885830 2011 p63RhoGEF couples G?(q/11)-mediated signaling to Ca2+ sensitization of vascular smooth muscle contractility.
21832057 2011 Plasma membrane association of p63 Rho guanine nucleotide exchange factor (p63RhoGEF) is mediated by palmitoylation and is required for basal activity in cells.
21663592 2011 GEFT, A Rho family guanine nucleotide exchange factor, regulates lens differentiation through a Rac1-mediated mechanism.
20739613 2010 p63RhoGEF--a key mediator of angiotensin II-dependent signaling and processes in vascular smooth muscle cells.
18936096 2008 Assembly of high order G alpha q-effector complexes with RGS proteins.
More...