Property Summary

NCBI Gene PubMed Count 22
PubMed Score 31.47
PubTator Score 22.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-02
atypical teratoid / rhabdoid tumor -2.000 1.5e-08
ependymoma -1.200 4.2e-03
glioblastoma -1.600 5.9e-05
group 4 medulloblastoma -1.100 1.2e-02
medulloblastoma, large-cell -1.900 2.4e-06
primitive neuroectodermal tumor -1.500 1.1e-03

Gene RIF (14)

AA Sequence

MRGGHKGGRCACPRVIRKVLAKCGCCFARGGRESYSIAGSEGSISASAASGLAAPSGPSSGLSSGPCSPG      1 - 70
PPGPVSGLRRWLDHSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEE     71 - 140
ETLSQAPESEEEQKKKALERSMYVLSELVETEKMYVDDLGQIVEGYMATMAAQGVPESLRGRDRIVFGNI    141 - 210
QQIYEWHRDYFLQELQRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHVVSEFGDSYFEELRQQLGH    211 - 280
RLQLNDLLIKPVQRIMKYQLLLKDFLKYYNRAGMDTADLEQAVEVMCFVPKRCNDMMTLGRLRGFEGKLT    281 - 350
AQGKLLGQDTFWVTEPEAGGLLSSRGRERRVFLFEQIIIFSEALGGGVRGGTQPGYVYKNSIKVSCLGLE    351 - 420
GNLQGDPCRFALTSRGPEGGIQRYVLQAADPAISQAWIKHVAQILESQRDFLNALQSPIEYQRRESQTNS    421 - 490
LGRPRGPGVGSPGRIQLGDQAQGSTHTPINGSLPSLLLSPKGEVARALLPLDKQALGDIPQAPHDSPPVS    491 - 560
PTPKTPPCQARLAKLDEDEL                                                      561 - 580
//

Text Mined References (25)

PMID Year Title