Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.72
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.540 6.0e-03
active ulcerative colitis 1.394 1.0e-02
Atopic dermatitis -1.300 3.1e-04
Breast cancer -1.200 2.7e-06
ductal carcinoma in situ -1.300 2.2e-03
ependymoma -1.200 9.2e-05
interstitial cystitis -1.100 3.9e-03
intraductal papillary-mucinous carcinoma... 1.400 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.800 2.2e-02
invasive ductal carcinoma -1.100 3.1e-03
non-small cell lung cancer -1.125 6.7e-13
osteosarcoma 1.470 5.8e-03
pancreatic cancer 1.100 1.1e-05
Pick disease 1.100 8.5e-05
primary pancreatic ductal adenocarcinoma 1.387 1.7e-02
psoriasis -1.200 3.3e-08
Rheumatoid arthritis 1.100 2.8e-02
subependymal giant cell astrocytoma -1.803 9.6e-03

Synonym

Accession Q86VW0 Q53R38 Q53SP3 Q5GM69 Q8N6M1 Q96LQ2
Symbols SOLO

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MEASVILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMDELSVTLDYLLSIPSEKCKARGFTVIVDGR      1 - 70
KSQWNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQ     71 - 140
LTEDFGGSLTYDHMDWLNKRLVFEKFTKESTSLLDELALINNGSDKGNQQEKERSVDLNFLPSVDPETVL    141 - 210
QTGHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQK    211 - 280
VMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLV    281 - 350
ELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLL    351 - 420
EEKLKSVDVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQRCEDMVDVRR    421 - 490
LKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQSTYDYGRQLLQ    491 - 560
ATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHRLEMAIAFHSNAEKILQDCPEEPEAINDEEQ    561 - 630
FDEIEAVGKSLLDRLTVPVVYPDGTEQYFGSPSDMASTAENIRDRMKLVNLKRQQLRHPEMVTTES        631 - 696
//

Text Mined References (12)

PMID Year Title