Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.02
PubTator Score 4.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Weight Gain 87
Disease Target Count P-value
non-small cell lung cancer 2798 4.0245719253446E-15
psoriasis 6685 3.34353555235961E-8
posterior fossa group B ependymoma 1530 9.77637900196674E-8
ulcerative colitis 2087 8.76884758611341E-7
Breast cancer 3099 2.74493878771634E-6
Pick disease 1893 8.46820339926E-5
Atopic dermatitis 944 3.1171153422092E-4
primary pancreatic ductal adenocarcinoma 1271 4.46467388404879E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.65337357983348E-4
ductal carcinoma in situ 1745 8.75271574471078E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00307490163215888
invasive ductal carcinoma 2950 0.00314423497408664
interstitial cystitis 2299 0.00392705440289897
osteosarcoma 7933 0.00582465245777438
active Crohn's disease 918 0.00603007161332738
pancreatic cancer 2300 0.00666175415715982
subependymal giant cell astrocytoma 2287 0.00960250481271652
Rheumatoid Arthritis 1171 0.0280211334841136
Disease Target Count Z-score Confidence
Bipolar Disorder 266 3.572 1.8

Expression

Pathway (1)

Gene RIF (5)

PMID Text
26676784 Upregulation of miR-532-5p and subsequent suppression of the SESTD1 and TAB3 genes represent an antiviral response aimed at limiting West Nile virus infection.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20164195 SESTD1 was found to associate with TRPC4 and TRPC5 via the channel's calmodulin- and inositol 1,4,5-trisphosphate receptor-binding domain.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of SEC14 and spectrin domains 1 (SESTD1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEASVILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMDELSVTLDYLLSIPSEKCKARGFTVIVDGR      1 - 70
KSQWNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQ     71 - 140
LTEDFGGSLTYDHMDWLNKRLVFEKFTKESTSLLDELALINNGSDKGNQQEKERSVDLNFLPSVDPETVL    141 - 210
QTGHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQK    211 - 280
VMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLV    281 - 350
ELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLL    351 - 420
EEKLKSVDVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQRCEDMVDVRR    421 - 490
LKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQSTYDYGRQLLQ    491 - 560
ATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHRLEMAIAFHSNAEKILQDCPEEPEAINDEEQ    561 - 630
FDEIEAVGKSLLDRLTVPVVYPDGTEQYFGSPSDMASTAENIRDRMKLVNLKRQQLRHPEMVTTES        631 - 696
//

Text Mined References (11)

PMID Year Title
26676784 2015 Human MicroRNA miR-532-5p Exhibits Antiviral Activity against West Nile Virus via Suppression of Host Genes SESTD1 and TAB3 Required for Virus Replication.
25416956 2014 A proteome-scale map of the human interactome network.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20164195 2010 The phospholipid-binding protein SESTD1 is a novel regulator of the transient receptor potential channels TRPC4 and TRPC5.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837271 2003 Representational difference analysis, high-resolution physical mapping, and transcript identification of the zebrafish genomic region for a motor behavior.
More...