Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $130,653.38
PubMed Score 5.02
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26676784 Upregulation of miR-532-5p and subsequent suppression of the SESTD1 and TAB3 genes represent an antiviral response aimed at limiting West Nile virus infection.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20164195 SESTD1 was found to associate with TRPC4 and TRPC5 via the channel's calmodulin- and inositol 1,4,5-trisphosphate receptor-binding domain.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of SEC14 and spectrin domains 1 (SESTD1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEASVILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMDELSVTLDYLLSIPSEKCKARGFTVIVDGR      1 - 70
KSQWNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQ     71 - 140
LTEDFGGSLTYDHMDWLNKRLVFEKFTKESTSLLDELALINNGSDKGNQQEKERSVDLNFLPSVDPETVL    141 - 210
QTGHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQK    211 - 280
VMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLV    281 - 350
ELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLL    351 - 420
EEKLKSVDVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQRCEDMVDVRR    421 - 490
LKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQSTYDYGRQLLQ    491 - 560
ATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHRLEMAIAFHSNAEKILQDCPEEPEAINDEEQ    561 - 630
FDEIEAVGKSLLDRLTVPVVYPDGTEQYFGSPSDMASTAENIRDRMKLVNLKRQQLRHPEMVTTES        631 - 696
//

Text Mined References (11)

PMID Year Title
26676784 2015 Human MicroRNA miR-532-5p Exhibits Antiviral Activity against West Nile Virus via Suppression of Host Genes SESTD1 and TAB3 Required for Virus Replication.
25416956 2014 A proteome-scale map of the human interactome network.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20164195 2010 The phospholipid-binding protein SESTD1 is a novel regulator of the transient receptor potential channels TRPC4 and TRPC5.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837271 2003 Representational difference analysis, high-resolution physical mapping, and transcript identification of the zebrafish genomic region for a motor behavior.
More...