Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.00
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18491143 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQNTENHDPVGSILIQIHEDLYQLKEKLTKFSPEEKGETLDIQSLETAIKRTEVGLRIHIEKYLNVVNQ      1 - 70
NVLTTSVNDESLYTPQASKWLLPTVIDQKSFIFPQESEGTFWQPQRQHSSSLPVFPRAKIKVSKLIKGSN     71 - 140
ISSLTVLPSSHCTDPYFTPIPVLQADAHKGILSMIERGLIPPTARITFQNPPITPRAAPLHSFDEARKIP    141 - 210
TVATFTIPREPPPSPAEVKFFPKKQRSKGKSRRSRGHHDRKAMKVKTPLRALKSLWDYDFLIYDGVIDNT    211 - 280
APDFLAFKEHFSLAWGGIFSLLEHVEKFLRNYAIPEVKIKGNNLVALLPEFELTNKLTRYDLLSVLEDPA    281 - 350
HVQMLINLPGQRYKGQDGNSEAAMKIQATWKCYKARKFFLFYRQQKWASGVIAIAWLLYCHKTRLKKILK    351 - 420
ESRQRHLENFRIRAKHLAANWNRIRTSRRTIIHIPSLGYSQPVREHIADFNTQQNMQLGRLCDILDANVN    421 - 490
VIYICSHHMNDELVLYYKKILSLHAAVKSGNLEDRSDLQDRFKIITPEAVNIFPKHHMCLATHLMYSPKA    491 - 560
IKRIKNLIRGTEAYIVSGLLHRDDLAVADMLDIPILGSEPELAHLYSTKSGGKRVFDSANVAVPPGIYDI    561 - 630
YSQQQMIEQLSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQE    631 - 700
PALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQGGVIEAFPPADNVTNLTVDMLIEPNGKISVL    701 - 770
STGDQLHAESPFISSGTTVPQTSVDPQVLTYLCLQIGKACRMRDVVGYFSIDLVTFIDPSTLEQQVWATG    771 - 840
LNLAYSDQLALTQLTLYLTNGHLDCSLSTLEVPRFVPKERKKTKCMSALSMPMLATSRYAVMTTQLRHSN    841 - 910
LSLVFHYVFLQICRAHGIGYDVEERQGTVFILYEHLKRHKLGMLTIGEDLQGVLMTFARHLFIIHQEISA    911 - 980
PNMQGETNFKTTIADIETILRVTKENKMRFEEEQQSKDDKNLSKPKK                           981 - 1027
//

Text Mined References (9)

PMID Year Title
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18491143 2008 Genome-wide association analysis with selective genotyping identifies candidate loci for adult height at 8q21.13 and 15q22.33-q23 in Mongolians.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15897968 2005 Identification of a novel testis-specific gene and its potential roles in testis development/spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.