Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 4
Funding $208,215.32
PubMed Score 8.00
PubTator Score 2.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (1)

PMID Text
25150169 FJX1 does not influence the levels of FAT1 ectodomain phosphorylation.

AA Sequence

MGRRMRGAAATAGLWLLALGSLLALWGGLLPPRTELPASRPPEDRLPRRPARSGGPAPAPRFPLPPPLAW      1 - 70
DARGGSLKTFRALLTLAAGADGPPRQSRSEPRWHVSARQPRPEESAAVHGGVFWSRGLEEQVPPGFSEAQ     71 - 140
AAAWLEAARGARMVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPL    141 - 210
ALARVEARGAQWAQVQEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSEDGRLRPLRDAGGELANLSQ    211 - 280
AELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVA    281 - 350
GMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARLLRLYRRHEPRFPELAALADPHAQLLQRRLDFL    351 - 420
AKHILHCKAKYGRRSGT                                                         421 - 437
//

Text Mined References (7)

PMID Year Title
25150169 2014 FAT1 cadherin is multiply phosphorylated on its ectodomain but phosphorylation is not catalysed by the four-jointed homologue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10568747 1999 A 7.5 Mb sequence-ready PAC contig and gene expression map of human chromosome 11p13-p14.1.
10072791 1999 Fjx1, the murine homologue of the Drosophila four-jointed gene, codes for a putative secreted protein expressed in restricted domains of the developing and adult brain.
7647465 1995 CpG island clones for chromosome 11p--a resource for mapping and gene identification.