Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.88
PubTator Score 6.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q86VQ3 A5YM73 Q8N7U4 Q96RX3 Q9H0L8
Symbols SPTRX
SPTRX1

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
21375472 The patients with advanced-stagemalignant pleural mesothelioma (MPM) showed higher levels of TRX than those with early-stage MPM.
12387870 spermatid-specific thioredoxin-1 (Sptrx-1) is a two-domain protein with oxidizing activity
11737268 sperm specific expression, together with chromosomal assignment to a position as a potential locus for flagellar anomalies and male infertility phenotypes, suggests that it might be a novel component of the human sperm axonemal organization.

AA Sequence

MDVDKELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQAKEKAFLPMVS      1 - 70
HTFHMRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQPKEGDIPKAPEETIQSKKEDLPKSSEK     71 - 140
AIQPKESNIPKSSAKPIQPKLGNIPKASVKPSQPKEGDIPKAPEETIQSKKEDLPKSSEEAIQPKEGDIP    141 - 210
KSSAKPIQPKLGNIAKTSVKPSQPKESDIPKSPEETIQPKEGDIPKSSAKPIQPKLGNIPKASVKPSQPK    211 - 280
EGDISKSPEEAIQPKEGDLPKSLEEAIQPKEGDIPKSPEEAIQPKEGDIPKSLEEAIQPKEGDIPKSPEE    281 - 350
TIQPKKGDIPKSPEEAIQPKEGDIPKSPKQAIQPKEGDIPKSLEEAIPPKEIDIPKSPEETIQPKEDDSP    351 - 420
KSLEEATPSKEGDILKPEEETMEFPEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFF    421 - 490
HALSVKHEDVVFLEVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAELK           491 - 553
//

Text Mined References (12)

PMID Year Title
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
21375472 2011 Is serum thioredoxin-1 a useful clinical marker for malignant pleural mesothelioma?
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12387870 2002 Human spermatid-specific thioredoxin-1 (Sptrx-1) is a two-domain protein with oxidizing activity.
11737268 2001 Sptrx-2, a fusion protein composed of one thioredoxin and three tandemly repeated NDP-kinase domains is expressed in human testis germ cells.
More...