Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.43
PubTator Score 18.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25843653 Carriers of the rs41423247 GLCCI1 polymorphism had a higher probability of responding to glucocorticoids, whereas all other polymorphisms did not affect the likelihood of response to treatment of graft-versus-host disease patients.
25724472 Carriers of the GLCCI1-C allele had lower levels of baseline rheumatoid arthritis disease activity, suggesting a role for the GLCCI1 gene in regulation of glucocorticoid sensitivity to endogenously produced cortisol.
25134782 the minor alleles "T" and "G" of rs37972 and rs37973 SNPs, respectively, were not significantly associated with increased asthma risk in asthma patients from Saudi Arabia
24897287 GLCCI1 rs37972 T allele was not significantly associated with an increased risk of oral corticosteroid use.
24673601 GLCCI1 variant accelerates pulmonary function decline in patients with asthma receiving inhaled corticosteroids.
24131825 GLCCI1 rs37973 does not influence treatment response to inhaled corticosteroids in white subjects with asthma.
23836780 Novel association was found between intraocular pressure and a common variant at 7p21 near to GLCCI1 and ICA1.
22796022 Studied the influence of GLCCI1 SNP rs37972 on dexamethasone efficacy in bacterial meningitis patients.Results show rs37972 in GLCCI1 is associated with death in patients with CA bacterial meningitis treated with adjunctive dexamethasone therapy.
22660954 GLCCI1 nucleotide polymorphisms associated with steroid-responsiveness in asthmatic patients are unlikely to have a clinically actionable impact in pediatric nephrotic syndrome.
22304573 Variation at GLCCI1 and FCER2 could lead personalized asthma treatment.
More...

AA Sequence

MSTASSSSSSSSSQTPHPPSQRMRRSAAGSPPAVAAAGSGNGAGGGGGVGCAPAAGAGRLLQPIRATVPY      1 - 70
QLLRGSQHSPTRPPVAAAAASLGSLPGPGAARGPSPSSPTPPAAAAPAEQAPRAKGRPRRSPESHRRSSS     71 - 140
PERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAE    141 - 210
EGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDRQSPLHGNHITISHTQATGSRSVPM    211 - 280
PLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNGKEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQT    281 - 350
PSVQERSSSCSSHSPCVSPFCPPESQDGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPP    351 - 420
EGCERVKVFEEMASRQPISAPLFSCPDKNKVNFIPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALA    421 - 490
TLTVEQLSSRVSFTSLSDDTSTAGSMEASVQQPSQQQQLLQELQGEDHISAQNYVII                 491 - 547
//

Text Mined References (32)

PMID Year Title
25843653 2015 GLCCI1 and Glucocorticoid Receptor Genetic Diversity and Response to Glucocorticoid-Based Treatment of Graft-versus-Host Disease.
25724472 2015 Polymorphisms in the glucocorticoid receptor gene and in the glucocorticoid-induced transcript 1 gene are associated with disease activity and response to glucocorticoid bridging therapy in rheumatoid arthritis.
25134782 2015 Rs37972 and rs37973 single-nucleotide polymorphisms in the glucocorticoid-inducible 1 gene are not associated with asthma risk in a Saudi Arabian population.
24897287 2014 Pharmacogenetic analysis of GLCCI1 in three north European pediatric asthma populations with a reported use of inhaled corticosteroids.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24673601 2014 GLCCI1 variant accelerates pulmonary function decline in patients with asthma receiving inhaled corticosteroids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24131825 2014 GLCCI1 rs37973 does not influence treatment response to inhaled corticosteroids in white subjects with asthma.
23836780 2013 Genome-wide association study of intraocular pressure identifies the GLCCI1/ICA1 region as a glaucoma susceptibility locus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...