Property Summary

NCBI Gene PubMed Count 25
PubMed Score 16.75
PubTator Score 24.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 4.9e-03
Breast cancer -1.300 9.0e-21
chronic rhinosinusitis -1.530 3.9e-02
cystic fibrosis and chronic rhinosinusit... -1.325 4.6e-02
ependymoma 1.400 1.4e-04
group 4 medulloblastoma 1.200 2.1e-02
head and neck cancer and chronic obstruc... -1.200 2.6e-02
lung adenocarcinoma -1.100 2.0e-12
osteosarcoma -1.578 1.0e-05

Gene RIF (12)

AA Sequence

MGERAGSPGTDQERKAGKHHYSYLSDFETPQSSGRSSLVSSSPASVRRKNPKRQTSDGQVHHQAPRKPSP      1 - 70
KGLPNRKGVRVGFRSQSLNREPLRKDTDLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQ     71 - 140
YRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEIS    141 - 210
EARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQR    211 - 280
LYHKLKEKERELDIKNIYSNRLPKSSPNKEKELALRKNAACQSDFADLCTKGVQTMEDFKPEEYPLTPET    281 - 350
IMCYENKWEEPGHLTLDLQSQKQDRHGEAGILNPIMEREEKFVTDEELHVVKQEVEKLEDEWEREELDKK    351 - 420
QKEKASLLEREEKPEWETGRYQLGMYPIQNMDKLQGEEEERLKREMLLAKLNEIDRELQDSRNLKYPVLP    421 - 490
LLPDFESKLHSPERSPKTYRFSESSERLFNGHHLQDISFSTPKGEGQNSGNVRSPASPNEFAFGSYVPSF    491 - 560
AKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASGSSTISSKSSDPNSVASS    561 - 630
KGDIDPLNFLPGNKGSRDQEHDEDEGFFLSEGRSFNPNRHRLKHADDKPAVKAADSVEDEIEEVALR       631 - 697
//

Text Mined References (26)

PMID Year Title