Property Summary

NCBI Gene PubMed Count 39
PubMed Score 77.82
PubTator Score 45.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.539 1.8e-10
adrenocortical carcinoma 1.113 2.1e-02
adult high grade glioma -1.100 1.0e-02
atypical teratoid / rhabdoid tumor -1.200 3.0e-03
ependymoma -1.300 2.7e-02
glioblastoma -1.200 2.0e-04
intraductal papillary-mucinous adenoma (... 1.400 2.0e-02
intraductal papillary-mucinous carcinoma... 1.400 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.200 9.1e-03
lung adenocarcinoma 1.152 2.7e-04
lung cancer 1.300 3.7e-04
nasopharyngeal carcinoma 1.200 7.6e-04
osteosarcoma 2.908 1.8e-05
ovarian cancer -1.300 2.4e-04
subependymal giant cell astrocytoma -1.892 5.2e-03
tuberculosis -1.100 1.5e-05

 GO Function (1)

Gene RIF (15)

AA Sequence

MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVK      1 - 70
CLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTS     71 - 140
AIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIV    141 - 210
FVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFE    211 - 280
SFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVR    281 - 350
RAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQ    351 - 420
GETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSS    421 - 490
SNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFD    491 - 560
ATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLGSDLPNTLQIFLERLKNEITRLTTVK    561 - 630
ALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPL    631 - 700
ISESDMHVSQMAISFLTTLAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNL    701 - 770
GYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALL    771 - 840
SLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLL    841 - 910
HSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSY    911 - 980
ARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLP    981 - 1050
HLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIK   1051 - 1120
MLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAE   1121 - 1190
KSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS                                 1191 - 1230
//

Text Mined References (52)

PMID Year Title