Property Summary

NCBI Gene PubMed Count 43
Grant Count 9
R01 Count 7
Funding $638,578.58
PubMed Score 28.72
PubTator Score 15.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.691 0.000
psoriasis -1.100 0.000
osteosarcoma -1.256 0.030
juvenile dermatomyositis 1.052 0.000
acute quadriplegic myopathy 1.157 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.005
intraductal papillary-mucinous neoplasm ... 1.200 0.016
spina bifida -1.219 0.042
ovarian cancer -1.200 0.000
dermatomyositis 1.100 0.001

Gene RIF (14)

PMID Text
26451915 we demonstrate that myosin VI and TAX1BP1 are recruited to ubiquitylated Salmonella and play a key role in xenophagy
26287441 The induction of antibodies to an AQP4 epitope in mice immunized with the TAX1BP1-derived peptide suggests that a latent HTLV-1 infection could lead to TAX1BP1 antigen presentation and the production of anti-AQP4 antibodies in human neuromyelitis optica.
24817723 A protein construct corresponding to the SKICH domain plus the linker region was expressed, purified and crystallized for TAX1BP1.
23308279 RNF11 functions together with TAX1BP1 to restrict antiviral signaling and IFN-beta production.
23209807 Autophagy of Tax1bp1/Ndp52 promotes non-canonical NF-kappaB signalling.
22997707 Allele frequencies of three Alu insertions that are located in MEF2C (two of them) and TAX1BP1 genes significantly differ between cohorts of healthy donors and ALL(acute lymphoblastic leukemia) patients.
21885437 ABIN1 requires its ubiquitin binding domain and cooperates with TAX1BP1 and A20 to restrict antiviral signaling.
21282516 In a link with T cell leukemia virus-1-associated myelopathy/tropical spastic paraparesis, an alphabeta T cell receptor recognizes a self peptide from neuronal protein HuD in context of histocompatibility antigen HLA-A2.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20549079 There is evidence of the association between the TAX1BP1 polymorphism and oral cavity cancer but there are no differences in the distribution of the polymorphism among patients with head and neck cancer and individuals without history of neoplasm.
More...

AA Sequence

MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSP      1 - 70
MPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDM     71 - 140
LVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVT    141 - 210
QSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEK    211 - 280
ELYKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTC    281 - 350
FLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAMKKD    351 - 420
QDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDA    421 - 490
SVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELA    491 - 560
KMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQ    561 - 630
PVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENV    631 - 700
PTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQ    701 - 770
QVFERHVQTHFDQNVLNFD                                                       771 - 789
//

Text Mined References (49)

PMID Year Title
26451915 2015 The Autophagy Receptor TAX1BP1 and the Molecular Motor Myosin VI Are Required for Clearance of Salmonella Typhimurium by Autophagy.
26287441 2015 Immunization of mice with a peptide derived from the HTLV-1 TAX1BP1 protein induces cross-reactive antibodies against aquaporin 4.
25416956 2014 A proteome-scale map of the human interactome network.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24817723 2014 Expression, purification and crystallization of the SKICH domain of human TAX1BP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239949 2014 The structure of TAX1BP1 UBZ1+2 provides insight into target specificity and adaptability.
23308279 2013 RING finger protein 11 targets TBK1/IKKi kinases to inhibit antiviral signaling.
23209807 2012 TBK1 kinase addiction in lung cancer cells is mediated via autophagy of Tax1bp1/Ndp52 and non-canonical NF-?B signalling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...