Property Summary

NCBI Gene PubMed Count 46
PubMed Score 30.36
PubTator Score 15.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.157 5.0e-05
dermatomyositis 1.100 7.1e-04
intraductal papillary-mucinous carcinoma... 1.200 4.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.1e-02
juvenile dermatomyositis 1.052 2.3e-10
Multiple myeloma 1.691 1.2e-05
osteosarcoma -1.256 3.0e-02
ovarian cancer -1.200 1.9e-05
psoriasis -1.100 3.9e-08
spina bifida -1.219 4.2e-02

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSP      1 - 70
MPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDM     71 - 140
LVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVT    141 - 210
QSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEK    211 - 280
ELYKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTC    281 - 350
FLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAMKKD    351 - 420
QDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDA    421 - 490
SVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELA    491 - 560
KMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQ    561 - 630
PVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENV    631 - 700
PTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQ    701 - 770
QVFERHVQTHFDQNVLNFD                                                       771 - 789
//

Text Mined References (53)

PMID Year Title