Property Summary

NCBI Gene PubMed Count 22
Grant Count 14
R01 Count 6
Funding $953,653.63
PubMed Score 17.92
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 0.029
posterior fossa group A ependymoma -1.300 0.000
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
non-small cell lung cancer -1.134 0.000
pediatric high grade glioma -1.600 0.000
Pick disease -1.600 0.000
Breast cancer -1.300 0.000
ovarian cancer -1.800 0.000

Gene RIF (12)

PMID Text
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 shRNA knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 supernatant levels when using wild type (HIV-1 LAI) and VSV-pseudotyped virus; HIV replication is enhanced by VPS36
26268989 shRNA knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 supernatant levels when using wild type (HIV-1 LAI) and VSV-pseudotyped virus; HIV replication is enhanced by VPS36
More...

AA Sequence

MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIE      1 - 70
EQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSL     71 - 140
QTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDIT    141 - 210
EDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGME    211 - 280
LLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV    281 - 350
LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS                                      351 - 386
//

Text Mined References (25)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18539118 2008 Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17714434 2007 Vps22/EAP30 in ESCRT-II mediates endosomal sorting of growth factor and chemokine receptors destined for lysosomal degradation.
17057716 2006 Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain.
More...