Tbio | Vacuolar protein-sorting-associated protein 36 |
Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3.
This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A similar protein complex in rat is associated with RNA polymerase elongation factor II. [provided by RefSeq, Aug 2013]
This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A similar protein complex in rat is associated with RNA polymerase elongation factor II. [provided by RefSeq, Aug 2013]
Comments
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 4.03889333917594E-21 |
posterior fossa group A ependymoma | 1511 | 1.58012041949112E-8 |
ovarian cancer | 8492 | 1.34079340577505E-7 |
pediatric high grade glioma | 2712 | 1.58004460822375E-7 |
Breast cancer | 3099 | 1.99735285445672E-7 |
atypical teratoid / rhabdoid tumor | 4369 | 3.27755654087225E-7 |
glioblastoma | 5572 | 7.13046062997823E-7 |
Pick disease | 1893 | 6.22535137511081E-5 |
astrocytic glioma | 2241 | 0.0294618447611204 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -1.300 | 0.029 |
posterior fossa group A ependymoma | -1.300 | 0.000 |
glioblastoma | -2.000 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.500 | 0.000 |
non-small cell lung cancer | -1.134 | 0.000 |
pediatric high grade glioma | -1.600 | 0.000 |
Pick disease | -1.600 | 0.000 |
Breast cancer | -1.300 | 0.000 |
ovarian cancer | -1.800 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
Fruitfly | OMA Inparanoid |
PMID | Text |
---|---|
26268989 | Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus |
26268989 | shRNA knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 supernatant levels when using wild type (HIV-1 LAI) and VSV-pseudotyped virus; HIV replication is enhanced by VPS36 |
17057716 | Crystallographic and biochemical analyses reveal that the GLUE domain of the human ESCRT-II EAP45 (also called VPS36) subunit is a split pleckstrin-homology domain that binds ubiquitin along one edge of the beta-sandwich. |
16371348 | mammalian ESCRTII is made up of hVps25p, hVps22p, and hVps36p and may be redundant, cargo-specific, or not required for protein sorting at the multivesicular body |
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIE 1 - 70 EQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSL 71 - 140 QTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDIT 141 - 210 EDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGME 211 - 280 LLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV 281 - 350 LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS 351 - 386 //
PMID | Year | Title |
---|---|---|
23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. |
21269460 | 2011 | Initial characterization of the human central proteome. |
20682791 | 2010 | A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components. |
20588296 | 2010 | Membrane budding and scission by the ESCRT machinery: it's all in the neck. |
19056867 | 2009 | Large-scale proteomics and phosphoproteomics of urinary exosomes. |
18539118 | 2008 | Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
17714434 | 2007 | Vps22/EAP30 in ESCRT-II mediates endosomal sorting of growth factor and chemokine receptors destined for lysosomal degradation. |
17057716 | 2006 | Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain. |
More... |