Property Summary

NCBI Gene PubMed Count 23
PubMed Score 19.76
PubTator Score 5.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Kaposi's sarcoma 22 3.078 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 1.8e-05
astrocytic glioma -1.300 2.9e-02
atypical teratoid / rhabdoid tumor -1.500 3.3e-07
Breast cancer -1.200 1.1e-11
ependymoma -1.200 6.0e-08
glioblastoma -1.300 7.8e-06
non-small cell lung cancer -1.134 4.0e-21
ovarian cancer -1.800 1.3e-07
Pick disease -1.600 6.2e-05

Gene RIF (5)

AA Sequence

MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIE      1 - 70
EQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSL     71 - 140
QTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDIT    141 - 210
EDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGME    211 - 280
LLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV    281 - 350
LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS                                      351 - 386
//

Text Mined References (26)

PMID Year Title