Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.92
PubTator Score 5.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.03889333917594E-21
posterior fossa group A ependymoma 1511 1.58012041949112E-8
ovarian cancer 8492 1.34079340577505E-7
pediatric high grade glioma 2712 1.58004460822375E-7
Breast cancer 3099 1.99735285445672E-7
atypical teratoid / rhabdoid tumor 4369 3.27755654087225E-7
glioblastoma 5572 7.13046062997823E-7
Pick disease 1893 6.22535137511081E-5
astrocytic glioma 2241 0.0294618447611204

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 0.029
posterior fossa group A ependymoma -1.300 0.000
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
non-small cell lung cancer -1.134 0.000
pediatric high grade glioma -1.600 0.000
Pick disease -1.600 0.000
Breast cancer -1.300 0.000
ovarian cancer -1.800 0.000

Synonym

Accession Q86VN1 A8K125 Q3ZCV7 Q5H9S1 Q5VXB6 Q9H8Z5 Q9Y3E3
Symbols EAP45
C13orf9
CGI-145

Gene

PDB

2HTH   2ZME   3CUQ  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

 GWAS Trait (1)

Gene RIF (4)

PMID Text
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 shRNA knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 supernatant levels when using wild type (HIV-1 LAI) and VSV-pseudotyped virus; HIV replication is enhanced by VPS36
17057716 Crystallographic and biochemical analyses reveal that the GLUE domain of the human ESCRT-II EAP45 (also called VPS36) subunit is a split pleckstrin-homology domain that binds ubiquitin along one edge of the beta-sandwich.
16371348 mammalian ESCRTII is made up of hVps25p, hVps22p, and hVps36p and may be redundant, cargo-specific, or not required for protein sorting at the multivesicular body

AA Sequence

MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIE      1 - 70
EQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSL     71 - 140
QTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDIT    141 - 210
EDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGME    211 - 280
LLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV    281 - 350
LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS                                      351 - 386
//

Text Mined References (25)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18539118 2008 Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17714434 2007 Vps22/EAP30 in ESCRT-II mediates endosomal sorting of growth factor and chemokine receptors destined for lysosomal degradation.
17057716 2006 Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain.
More...