Property Summary

Ligand Count 8
NCBI Gene PubMed Count 22
PubMed Score 47.13
PubTator Score 32.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.200 1.7e-02
ependymoma 2.200 8.6e-05
facioscapulohumeral dystrophy 1.500 2.5e-02
psoriasis 1.100 4.1e-06

Gene RIF (15)

AA Sequence

MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASV      1 - 70
TLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLF     71 - 140
RQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWLKGQEEESPFQTPGLSILHPSHSHLSRASFH    141 - 210
LFQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGW    211 - 280
SSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCV    281 - 350
RVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF    351 - 420
EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTA    421 - 490
RLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAH    491 - 560
ALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILATRH                                561 - 602
//

Text Mined References (24)

PMID Year Title