Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
Funding $282,561.67
PubMed Score 41.16
PubTator Score 32.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26290023 No association was found between Apa1 genotypes and osteoporosis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18470879 VDR polymorphism genotypes and haplotypes did not directly alter recurrence risk, but the reduction in risk associated with high dairy product intake was confined to individuals with ApaI aA/AA genotype.
12370286 APA1 has a role in inducing extracellular matrix remodeling genes

AA Sequence

MLSDELESKPELLVQFVQNTSIPLGQGLVESEAKDITCLSLLPVTEASECSRLMLPDDTTNHSNSSKEVP      1 - 70
SSAVLRSLRVNVGPDGEETRAQTVQKSPEFLSTSESSSLLQDLQPSDSTSFILLNLTRAGLGSSAEHLVF     71 - 140
VQDEAEDSGNDFLSSESTDSSIPWFLRVQELAHDSLIAATRAQLAKNAKTSSNGENVHLGSGDGQSKDSG    141 - 210
PLPQVEKKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFM    211 - 280
CHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVHSGEKPHQCQVCGKTFSQ    281 - 350
SGSRNVHMRKHHLQLGAAGSQEQEQTAEPLMGSSLLEEASVPSKNLVSMNSQPSLGGESLNLPNTNSILG    351 - 420
VDDEVLAEGSPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT                421 - 478
//

Text Mined References (12)

PMID Year Title
26290023 [Apa1 VDR polymorphism and osteoporosis risk in postmenopausal Mexican women].
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18470879 2008 Dairy products, polymorphisms in the vitamin D receptor gene and colorectal adenoma recurrence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370286 2002 Induction of extracellular matrix-remodeling genes by the senescence-associated protein APA-1.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...