Property Summary

NCBI Gene PubMed Count 66
Grant Count 2
Funding $197,626.75
PubMed Score 76.30
PubTator Score 84.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (56)

PMID Text
26383850 Findings provide evidence that LAPTM4B plays an important role in promoting tumor angiogenesis.
26343532 Our study points to the relevance of LAPTM4B expression to NSCLC pathogenesis as well as to the probable role of LAPTM4B/NRF2 signaling in promoting lung cancer cell survival.
26280656 By compartmentalizing ceramide, LAPTM4B controls key sphingolipid-mediated cell death mechanisms and emerges as a candidate for sphingolipid-targeting cancer therapies.
26126825 LAPTM4B binds to GARP and is a negative regulator of TGF-beta1 production in human Tregs
25998567 LAPTM4b recruits LAT1-4F2hc to lysosomes, leading to uptake of leucine into lysosomes.
25910706 LAPTM4B-35 overexpression is associated with small cell lung cancer.
25849595 These findings indicate that LAPTM4B-35 overexpression may be related to GC progression and poor prognosis, and thus may serve as a new prediction marker of prognosis in GC patients.
25714029 Authors found that restoration of miR-188-5p can inhibit the PI3K/AKT signaling pathway via the suppression of LAPTM4B.
25689860 LAPTM4B-35 over-expression was an independent factor in gastric carcinoma prognosis
25588945 The results reveal an essential layer of EGFR trafficking regulated by LAPTM4B, PtdIns(4,5)P2 signaling, and the ESCRT complex and define a mechanism by which the oncoprotein LAPTM4B can transform cells and promote tumor progression.
More...

AA Sequence

MELHERPDERRKARTSTQGRLGDWRRVHADGFTHRVLGAPAAAWSSSSWLEPAMTSRTRVTWPSPPRPLP      1 - 70
VPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARAT     71 - 140
APGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPDQYNFSSSELGGDFEF    141 - 210
MDDANMCIAIAISLLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQL    211 - 280
PPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPP    281 - 350
YDDATVNGAAKEPPPPYVSA                                                      351 - 370
//

Text Mined References (66)

PMID Year Title
26383850 2015 LAPTM4B down regulation inhibits the proliferation, invasion and angiogenesis of HeLa cells in vitro.
26343532 2015 LAPTM4B is associated with poor prognosis in NSCLC and promotes the NRF2-mediated stress response pathway in lung cancer cells.
26280656 2015 LAPTM4B facilitates late endosomal ceramide export to control cell death pathways.
26126825 2015 Lysosomal-associated Transmembrane Protein 4B (LAPTM4B) Decreases Transforming Growth Factor ?1 (TGF-?1) Production in Human Regulatory T Cells.
25998567 2015 LAPTM4b recruits the LAT1-4F2hc Leu transporter to lysosomes and promotes mTORC1 activation.
25910706 2015 Lysosome-associated protein transmembrane-4?-35 is a novel independent prognostic factor in small cell lung cancer.
25849595 2015 LAPTM4B-35, a cancer-related gene, is associated with poor prognosis in TNM stages I-III gastric cancer patients.
25714029 2015 miR-188-5p inhibits tumour growth and metastasis in prostate cancer by repressing LAPTM4B expression.
25689860 2015 Lysosomal-associated protein transmembrane 4 Beta-35 overexpression is a novel independent prognostic marker for gastric carcinoma.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
More...