Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.17
PubTator Score 6.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.48656717317474E-61
breast carcinoma 1614 1.34124187948261E-41
non-small cell lung cancer 2798 3.04651709199589E-27
Breast cancer 3099 1.04457426296929E-24
lung adenocarcinoma 2714 3.13255610979701E-16
atypical teratoid / rhabdoid tumor 4369 1.03164442341087E-10
glioblastoma 5572 4.2604990213487E-9
ovarian cancer 8492 2.30622285803373E-8
posterior fossa group A ependymoma 1511 3.74370188929221E-7
pediatric high grade glioma 2712 8.23085965872512E-7
group 3 medulloblastoma 2254 1.05936846076725E-6
Atopic dermatitis 944 2.6736723873068E-6
pancreatic cancer 2300 3.55244280619912E-6
cystic fibrosis 1670 7.49293773721155E-6
medulloblastoma, large-cell 6234 1.2838313672631E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.58017068001211E-5
invasive ductal carcinoma 2950 1.53119849252304E-4
primitive neuroectodermal tumor 3031 2.03532758270522E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.85335276126124E-4
osteosarcoma 7933 0.00124337092932089
adrenocortical carcinoma 1427 0.00489394208549491
nasopharyngeal carcinoma 1056 0.00505467330889109
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0119159484025505
ductal carcinoma in situ 1745 0.0120217617486283
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0153839985030196
Endometriosis 535 0.0156944061614666
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q86VI3 Q5T3H8
Symbols

Gene

PANTHER Protein Class (2)

PDB

3ISU  

  Ortholog (8)

Gene RIF (5)

PMID Text
25722290 IQGAP1, IQGAP2, and IQGAP3 have diverse roles in vertebrate physiology, operating in the kidney, nervous system, cardiovascular system, pancreas, and lung. (Review)
25229330 Mammalian IQGAP proteins may play a role in cytokinesis by regulating the localization of key cytokinesis regulatory proteins to the contractile apparatus during mitosis.
24849319 IQGAP3 may contribute to the pathogenesis of lung cancer by modulating EGFR-ERK signaling
21299499 The first IQ-motifs from IQGAP2 and IQGAP3 form transient interactions with calmodulin in the absence of calcium.
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERRAAGPGWAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEESLRNGVLLAK      1 - 70
LGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPSTFFPETTDIYDKKNMPRVVY     71 - 140
CIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELAKYGLQLPAFSKIGGILANELSVDEAAVHAA    141 - 210
VLAINEAVERGVVEDTLAALQNPSALLENLREPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLT    211 - 280
QAEIQGNINHVNVHGALEVVDDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLNSDREQKAQELG    281 - 350
LVELLEKEEVQAGVAAANTKGDQEQAMLHAVQRINKAIRRRVAADTVKELMCPEAQLPPVYPVASSMYQL    351 - 420
ELAVLQQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGENAQRYFDALLK    421 - 490
LRQERGMGEDFLSWNDLQATVSQVNAQTQEETDRVLAVSLINEALDKGSPEKTLSALLLPAAGLDDVSLP    491 - 560
VAPRYHLLLVAAKRQKAQVTGDPGAVLWLEEIRQGVVRANQDTNTAQRMALGVAAINQAIKEGKAAQTER    561 - 630
VLRNPAVALRGVVPDCANGYQRALESAMAKKQRPADTAFWVQHDMKDGTAYYFHLQTFQGIWEQPPGCPL    631 - 700
NTSHLTREEIQSAVTKVTAAYDRQQLWKANVGFVIQLQARLRGFLVRQKFAEHSHFLRTWLPAVIKIQAH    701 - 770
WRGYRQRKIYLEWLQYFKANLDAIIKIQAWARMWAARRQYLRRLHYFQKNVNSIVKIQAFFRARKAQDDY    771 - 840
RILVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMDIKIGLLVKNRI    841 - 910
TLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEKRQKLEAYQHLFYLLQTQPIYLAKLIFQMPQN    911 - 980
KTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEIKSKVEQPQDVVTGNPTVVRLVVRFYRNGRGQS    981 - 1050
ALQEILGKVIQDVLEDKVLSVHTDPVHLYKNWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDIALR   1051 - 1120
NLLAMTDKFLLAITSSVDQIPYGMRYVAKVLKATLAEKFPDATDSEVYKVVGNLLYYRFLNPAVVAPDAF   1121 - 1190
DIVAMAAGGALAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPEPE   1191 - 1260
ERFAVDEYSDMVAVAKPMVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLEDLGELPTIPDLIGESIA   1261 - 1330
ADGHTDLSKLEVSLTLTNKFEGLEADADDSNTRSLLLSTKQLLADIIQFHPGDTLKEILSLSASREQEAA   1331 - 1400
HKQLMSRRQACTAQTPEPLRRHRSLTAHSLLPLAEKQRRVLRNLRRLEALGLVSARNGYQGLVDELAKDI   1401 - 1470
RNQHRHRHRRKAELVKLQATLQGLSTKTTFYEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAA   1471 - 1540
QLLEKGVLVEIEDLPASHFRNVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLF   1541 - 1610
NKAKVNVNLLIFLLNKKFLRK                                                    1611 - 1631
//

Text Mined References (14)

PMID Year Title
25722290 2015 The biology of IQGAP proteins: beyond the cytoskeleton.
25229330 2014 Involvement of IQGAP family proteins in the regulation of mammalian cell cytokinesis.
24849319 2014 IQGAP3 promotes EGFR-ERK signaling and the growth and metastasis of lung cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21299499 2011 IQ-motif selectivity in human IQGAP2 and IQGAP3: binding of calmodulin and myosin essential light chain.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...