Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.62
PubTator Score 6.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 1.032 4.9e-03
adult high grade glioma 1.800 2.6e-05
Atopic dermatitis 2.100 2.7e-06
atypical teratoid / rhabdoid tumor 2.200 1.0e-10
Breast cancer 2.900 1.0e-24
breast carcinoma 1.300 1.3e-41
cystic fibrosis -1.869 7.5e-06
ductal carcinoma in situ 1.700 1.2e-02
Endometriosis 1.329 1.6e-02
ependymoma 1.300 2.3e-07
glioblastoma 2.300 4.3e-09
group 3 medulloblastoma 2.800 1.1e-06
intraductal papillary-mucinous adenoma (... 1.900 1.2e-02
intraductal papillary-mucinous carcinoma... 3.600 3.6e-05
intraductal papillary-mucinous neoplasm ... 4.400 2.9e-04
invasive ductal carcinoma 2.000 1.5e-04
lung adenocarcinoma 1.200 3.1e-16
medulloblastoma, large-cell 2.000 1.3e-05
nasopharyngeal carcinoma 1.100 5.1e-03
non-small cell lung cancer 1.586 3.0e-27
osteosarcoma -1.740 1.2e-03
ovarian cancer 1.700 2.3e-08
pancreatic cancer 1.500 3.6e-06
pancreatic ductal adenocarcinoma liver m... 1.174 1.5e-02
primitive neuroectodermal tumor 2.600 2.0e-04
psoriasis 1.200 2.5e-61

Gene RIF (7)

AA Sequence

MERRAAGPGWAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEESLRNGVLLAK      1 - 70
LGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPSTFFPETTDIYDKKNMPRVVY     71 - 140
CIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELAKYGLQLPAFSKIGGILANELSVDEAAVHAA    141 - 210
VLAINEAVERGVVEDTLAALQNPSALLENLREPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLT    211 - 280
QAEIQGNINHVNVHGALEVVDDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLNSDREQKAQELG    281 - 350
LVELLEKEEVQAGVAAANTKGDQEQAMLHAVQRINKAIRRRVAADTVKELMCPEAQLPPVYPVASSMYQL    351 - 420
ELAVLQQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGENAQRYFDALLK    421 - 490
LRQERGMGEDFLSWNDLQATVSQVNAQTQEETDRVLAVSLINEALDKGSPEKTLSALLLPAAGLDDVSLP    491 - 560
VAPRYHLLLVAAKRQKAQVTGDPGAVLWLEEIRQGVVRANQDTNTAQRMALGVAAINQAIKEGKAAQTER    561 - 630
VLRNPAVALRGVVPDCANGYQRALESAMAKKQRPADTAFWVQHDMKDGTAYYFHLQTFQGIWEQPPGCPL    631 - 700
NTSHLTREEIQSAVTKVTAAYDRQQLWKANVGFVIQLQARLRGFLVRQKFAEHSHFLRTWLPAVIKIQAH    701 - 770
WRGYRQRKIYLEWLQYFKANLDAIIKIQAWARMWAARRQYLRRLHYFQKNVNSIVKIQAFFRARKAQDDY    771 - 840
RILVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMDIKIGLLVKNRI    841 - 910
TLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEKRQKLEAYQHLFYLLQTQPIYLAKLIFQMPQN    911 - 980
KTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEIKSKVEQPQDVVTGNPTVVRLVVRFYRNGRGQS    981 - 1050
ALQEILGKVIQDVLEDKVLSVHTDPVHLYKNWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDIALR   1051 - 1120
NLLAMTDKFLLAITSSVDQIPYGMRYVAKVLKATLAEKFPDATDSEVYKVVGNLLYYRFLNPAVVAPDAF   1121 - 1190
DIVAMAAGGALAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPEPE   1191 - 1260
ERFAVDEYSDMVAVAKPMVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLEDLGELPTIPDLIGESIA   1261 - 1330
ADGHTDLSKLEVSLTLTNKFEGLEADADDSNTRSLLLSTKQLLADIIQFHPGDTLKEILSLSASREQEAA   1331 - 1400
HKQLMSRRQACTAQTPEPLRRHRSLTAHSLLPLAEKQRRVLRNLRRLEALGLVSARNGYQGLVDELAKDI   1401 - 1470
RNQHRHRHRRKAELVKLQATLQGLSTKTTFYEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAA   1471 - 1540
QLLEKGVLVEIEDLPASHFRNVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLF   1541 - 1610
NKAKVNVNLLIFLLNKKFLRK                                                    1611 - 1631
//

Text Mined References (16)

PMID Year Title