Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.56
PubTator Score 3.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.700 3.7e-02
atypical teratoid / rhabdoid tumor -3.100 8.8e-09
glioblastoma -2.000 1.4e-02
group 4 medulloblastoma -2.900 6.1e-04
lung cancer -1.300 4.2e-04
medulloblastoma, large-cell -3.500 7.5e-05
non-small cell lung carcinoma -1.100 8.7e-16
posterior fossa group B ependymoma -1.300 7.9e-03

 MGI Phenotype (1)

Gene RIF (1)

AA Sequence

MGFHLITQLKGMSVVLVLLPTLLLVMLTGAQRACPKNCRCDGKIVYCESHAFADIPENISGGSQGLSLRF      1 - 70
NSIQKLKSNQFAGLNQLIWLYLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDL     71 - 140
SYNKLQTLQSEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKEL    141 - 210
HLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSISQGLTWTWSSLHNLDLSGNDIQGIEPGTFKCLPNLQ    211 - 280
KLNLDSNKLTNISQETVNAWISLISITLSGNMWECSRSICPLFYWLKNFKGNKESTMICAGPKHIQGEKV    281 - 350
SDAVETYNICSEVQVVNTERSHLVPQTPQKPLIIPRPTIFKPDVTQSTFETPSPSPGFQIPGAEQEYEHV    351 - 420
SFHKIIAGSVALFLSVAMILLVIYVSWKRYPASMKQLQQHSLMKRRRKKARESERQMNSPLQEYYVDYKP    421 - 490
TNSETMDISVNGSGPCTYTISGSRECEMPHHMKPLPYYSYDQPVIGYCQAHQPLHVTKGYETVSPEQDES    491 - 560
PGLELGRDHSFIATIARSAAPAIYLERIAN                                            561 - 590
//

Text Mined References (9)

PMID Year Title