Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.56
PubTator Score 3.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 8.69014859032047E-16
atypical teratoid / rhabdoid tumor 4369 8.84456017385395E-9
medulloblastoma 1524 2.08473309377004E-7
medulloblastoma, large-cell 6234 7.47608493455147E-5
lung cancer 4473 4.21124661951152E-4
posterior fossa group B ependymoma 1530 0.0079394236312926
glioblastoma 5572 0.013748323129093
adult high grade glioma 2148 0.0368722979554435

Expression

  Differential Expression (8)

Disease log2 FC p
medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
glioblastoma -2.000 0.014
medulloblastoma, large-cell -3.500 0.000
lung cancer -1.300 0.000
adult high grade glioma -1.700 0.037
posterior fossa group B ependymoma -1.300 0.008
non-small cell lung carcinoma -1.100 0.000

Synonym

Accession Q86VH4 Q4FZ98 Q6UXJ7
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGFHLITQLKGMSVVLVLLPTLLLVMLTGAQRACPKNCRCDGKIVYCESHAFADIPENISGGSQGLSLRF      1 - 70
NSIQKLKSNQFAGLNQLIWLYLDHNYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDL     71 - 140
SYNKLQTLQSEQFKGLRKLIILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKEL    141 - 210
HLEHNQFSKINFAHFPRLFNLRSIYLQWNRIRSISQGLTWTWSSLHNLDLSGNDIQGIEPGTFKCLPNLQ    211 - 280
KLNLDSNKLTNISQETVNAWISLISITLSGNMWECSRSICPLFYWLKNFKGNKESTMICAGPKHIQGEKV    281 - 350
SDAVETYNICSEVQVVNTERSHLVPQTPQKPLIIPRPTIFKPDVTQSTFETPSPSPGFQIPGAEQEYEHV    351 - 420
SFHKIIAGSVALFLSVAMILLVIYVSWKRYPASMKQLQQHSLMKRRRKKARESERQMNSPLQEYYVDYKP    421 - 490
TNSETMDISVNGSGPCTYTISGSRECEMPHHMKPLPYYSYDQPVIGYCQAHQPLHVTKGYETVSPEQDES    491 - 560
PGLELGRDHSFIATIARSAAPAIYLERIAN                                            561 - 590
//

Text Mined References (8)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12676565 2003 A novel gene family encoding leucine-rich repeat transmembrane proteins differentially expressed in the nervous system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.